DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17265 and ccdc85a

Sequence 1:NP_608734.2 Gene:CG17265 FlyBaseID:FBgn0031488 Length:607 Species:Drosophila melanogaster
Sequence 2:XP_002936874.2 Gene:ccdc85a XenbaseID:XB-GENE-954470 Length:380 Species:Xenopus tropicalis

Alignment Length:351 Identity:112/352 (32%)
Similarity:164/352 (47%) Gaps:72/352 (20%)


  Fly   285 LTAEQNRQLQSLVNELRALKEQNQRLLDDNQELRDLCCFLDDDRQKGRKLAREWQRFGRYTASVM 349
            |..|.||:||..:.|:|.||:.||:|.:|||||||||||||||||||:|::|||||.||||:.:|
 Frog    50 LIREVNRRLQLHLGEIRGLKDVNQKLQEDNQELRDLCCFLDDDRQKGKKISREWQRLGRYTSGIM 114

  Fly   350 RQEVAAYQNKLRQLDDKQQELITDNLELKELCLYLDEERAHVAAN--------ALCAGCGAATRN 406
            ::||..|..||:.|:.:|:|::.:|:||||:|..||||:...|.:        :|| ........
 Frog   115 QKEVTLYLQKLKDLEVRQEEMVKENVELKEICFLLDEEKTGGAGSRSSIDSQTSLC-HLNTTAST 178

  Fly   407 ALRDDGDGSS---------------SSTNADETITALRNYAEQRQLPQDLRHAHTLNDQTLQYVR 456
            .|||.|||||               :|||:.|.:...|....    |:..:|.:...|. ||..|
 Frog   179 FLRDVGDGSSTSSAGSTDSPDHHKPNSTNSPEHLQKNRGEGS----PEHQKHGNGSPDH-LQKNR 238

  Fly   457 SLERRIQQLEEERTTPTAH---------LQQPTTPTPQATPTPTVTSAATPAK------------ 500
            |......|...:.::|..|         .|:.|..:|:......::|:....|            
 Frog   239 SSASPDHQKHVKSSSPEHHKSVGKSSPEQQKHTCSSPENLQKQMLSSSPELFKKHRSGGSPEYQK 303

  Fly   501 -SAASPHQQQQQ----QQQHQQQQQDIVAAAAAAAAAIQLPEPIAGRPEAVVRALQVLEVREQLE 560
             |:|||...|:.    ..:|.|:        |..::...|.....|.||    .|::|.     .
 Frog   304 LSSASPEHLQKHTLSGNSEHLQK--------ARGSSPEHLRPHFGGSPE----HLKLLS-----G 351

  Fly   561 RDRLGNLAGSALDQMDDGEKALVREM 586
            ..|.|.|.....|:|....:::...|
 Frog   352 SSREGTLRRQVADEMSAHHRSVYNGM 377

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17265NP_608734.2 DUF2216 <283..389 CDD:287229 61/104 (59%)
ccdc85aXP_002936874.2 DUF2216 10..183 CDD:287229 67/134 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3819
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1393196at2759
OrthoFinder 1 1.000 FOG0001232
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.870

Return to query results.
Submit another query.