DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17265 and ccdc85a

Sequence 1:NP_608734.2 Gene:CG17265 FlyBaseID:FBgn0031488 Length:607 Species:Drosophila melanogaster
Sequence 2:XP_009305551.1 Gene:ccdc85a ZFINID:ZDB-GENE-080220-55 Length:424 Species:Danio rerio

Alignment Length:319 Identity:108/320 (34%)
Similarity:151/320 (47%) Gaps:75/320 (23%)


  Fly   285 LTAEQNRQLQSLVNELRALKEQNQRLLDDNQELRDLCCFLDDDRQKGRKLAREWQRFGRYTASVM 349
            |..|.||:||..:||:|.|||.||:|.:|||||||||||||||||||:|::|||||.|||:|.:|
Zfish    61 LIREVNRRLQQHLNEIRGLKEVNQKLQEDNQELRDLCCFLDDDRQKGKKVSREWQRLGRYSAGIM 125

  Fly   350 RQEVAAYQNKLRQLDDKQQELITDNLELKELCLYLDEER-AHVAANALCAGCGAATRNA------ 407
            |:||..|..||::|:.:|:|::.:||||:||||.||||: :...:.::..|..|..||:      
Zfish   126 RKEVTLYLQKLKELEQRQEEVVRENLELRELCLMLDEEKGSGGTSGSVGTGGPAGCRNSIDSQSS 190

  Fly   408 -----------LRDDGDGSSSSTNADETITALRNYAEQRQLPQDLRHAHTLNDQTLQYVRSLERR 461
                       |||.|||||:|:            |.....|..|.|.                 
Zfish   191 LSHASGPGPGLLRDVGDGSSTSS------------AGSTDSPDHLTHK----------------- 226

  Fly   462 IQQLEEERTTPTAHLQQPTTPTPQATPTPTVTSAATPAKSAASPHQQQQQQQQHQQQQQDIVAAA 526
             |||          |..|...:|.....|.....|...::.:..|...|:...|...|  :..:.
Zfish   227 -QQL----------LGGPVGGSPDHLHKPGSGEEAPGPENPSRRHSTSQEYAAHTFPQ--VCRSR 278

  Fly   527 AAAAAAIQ-------LPEPIA--GRPEAVVRALQVLEVRE------QLERDRLGNLAGS 570
            ..:.::..       .||.:|  |.||...:.|.|.....      |..|..:|::.||
Zfish   279 CGSFSSPDHKGLRGLSPEKLAKRGSPEQFSKHLLVSSQPPGSPDLFQKHRGSMGSVCGS 337

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17265NP_608734.2 DUF2216 <283..389 CDD:287229 66/105 (63%)
ccdc85aXP_009305551.1 DUF2216 21..205 CDD:287229 73/144 (51%)
MdoG <295..342 CDD:302819 13/44 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3819
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 201 1.000 Inparanoid score I3666
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1393196at2759
OrthoFinder 1 1.000 FOG0001232
OrthoInspector 1 1.000 T597684
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR13546
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
77.020

Return to query results.
Submit another query.