DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Chd1 and kis

Sequence 1:NP_001245851.1 Gene:Chd1 FlyBaseID:FBgn0250786 Length:1900 Species:Drosophila melanogaster
Sequence 2:NP_001137761.1 Gene:kis FlyBaseID:FBgn0266557 Length:5517 Species:Drosophila melanogaster

Alignment Length:2269 Identity:554/2270 (24%)
Similarity:861/2270 (38%) Gaps:729/2270 (32%)


  Fly     9 PDKSKQFDPGCRALNESANSI-------------GSDEQDDTREEANGTDH------SGSGSG-- 52
            |...|..||......|:..::             |.|..:.|.|.:...|:      :||..|  
  Fly  1325 PKAKKPKDPNDPNSTETPAAVKKRAGASKRRKQYGEDGAEQTGEGSEVEDNKPLVPKAGSADGEA 1389

  Fly    53 ---SGSSGSDSDS-----------------------------DSSSGNSSDGRSSPEPEDKSLSV 85
               ||.:|.|.:|                             ||...::.|..|:|...|:..|.
  Fly  1390 ETTSGGTGVDGESPDYDDIPVSKIPRGSNEDEKEAEAGDETVDSVPDSAGDPASTPSRRDRKRST 1454

  Fly    86 AGFPPTAAAAQADS--KTNGF-----------------TDDQEDSSSDGSSGSDSDSDAEGPSDQ 131
            |.....|.:.:..|  |..|.                 ..|.||.:.|.:.......|:|..|::
  Fly  1455 ARSRRNANSEEGGSARKNRGSLSAKALKKRRNRGRIVPESDGEDDTLDRTPPPSPPPDSEMDSNK 1519

  Fly   132 RNQSIN--------------------------------------NANTSSSLPK--PEQNEEEDN 156
            |..|.|                                      |:|..|.:.|  |:...|.|.
  Fly  1520 RRSSRNTQRKKYIDDVMLRFSDDENSLLVASPVKKDKKPSANASNSNAGSDVEKTEPQSGAEGDA 1584

  Fly   157 ETEAGQQQ---PASDASADESSDSSANVS------PTSSSSSSEEEEEDYRPKRT---------- 202
            ..|.|:::   |..::|..|:|.|::.|:      .|.:::::...:.:|....|          
  Fly  1585 AQEVGEEKSNLPLDESSQLEASSSTSAVAEKERQISTDAANAAMSSKPNYVYINTGDEDSMVVQL 1649

  Fly   203 ----RQARKPPTAAEKSKKAPAPKNKKKTWDSDE-SDESEDSDDEVSTAQKRKPAATTS-----R 257
                |..::.....:..:|||.||..::..:.|| :.:..:.|::..|..:.|...|.|     .
  Fly  1650 VLAMRMGKRELILDKPKEKAPEPKQDEEKSELDEATTDKPEGDEKFKTEGESKKDLTDSEETKLE 1714

  Fly   258 SKLAQQQQRRRVKPFSSEDSDDDDASKRCATRRKGAAVSYKEASEDEATDS----EDLLEFEYDE 318
            |...:...:...:|..|:.||:|:..|...........|.||:..:|.:::    |:....|.|:
  Fly  1715 SSAMEVDSKEESEPDDSKKSDEDNKDKDKMEVDDEVGKSDKESKPEEQSETVKTEENSKAIEEDK 1779

  Fly   319 SQAATTAATAEEE----EKCETIERILAQRAGKRGCTGNQTTIYAIEENGFDPHAGFDEKQTPDA 379
            |....||..|:|.    ||.|..|:          ...:|:.:...|        |.|||.|.|:
  Fly  1780 SSTVLTADHAKEPETVLEKMEVDEK----------ANDDQSAVSKAE--------GSDEKSTDDS 1826

  Fly   380 ------------------------------------ETEA--------------QFLIKWKGWSY 394
                                                :|||              ::.:|::.:||
  Fly  1827 NPEEATTEKNKESLEIEGEKERVKEGEESVKKENDEKTEADMENKPEPVFIDVEEYFVKYRNFSY 1891

  Fly   395 IHNTWESEATLRDMKAKGMKKLDNFIKKEKEQAYWRRYAGPEDIDYFECQLELQHE-LLKSYNNV 458
            :|..|.:|..|.....:...|:..|.:|:.:|           ::.||   .::.| ..:.:..|
  Fly  1892 LHCEWRTEEELLKGDRRVAAKIRRFQQKQSQQ-----------LNIFE---NIEDEPFNQDFTEV 1942

  Fly   459 DRIIAKGSKPD----DGTEEYLCKWQSLPYAESTWEDAALV----LRKWQRCAEQFNDRESSKCT 515
            ||::......|    :.|:.||.||:||||.:.|||....|    :.::.|    ||.      .
  Fly  1943 DRVLDMSVHTDETSGETTKHYLVKWKSLPYEDCTWELEEDVDNDKIEQYLR----FNK------I 1997

  Fly   516 PSRHCRVIKYRPK---FSRIKNQPEFLSSGLTLRDYQMDGLNWLLHSWCKENSVILADEMGLGKT 577
            |.|.....|.||.   :.:::..|.: ..|.:||.||::|||||..||...::.|||||||||||
  Fly  1998 PQRSEWKSKKRPHPELWKKLEKTPVY-KGGNSLRPYQLEGLNWLKFSWYNTHNCILADEMGLGKT 2061

  Fly   578 IQTICFLYSLFKIHHLYGPFLCVVPLSTMTAWQREFDLWAPDMNVVTYLGDIKSRELIQQYEWQF 642
            ||::.|::|::: :.:.||||.:.||||:..|||||:.|. |||||.|.|.:.|:::||.||:.:
  Fly  2062 IQSLTFVHSVYE-YGIRGPFLVIAPLSTIPNWQREFEGWT-DMNVVVYHGSVTSKQMIQDYEYYY 2124

  Fly   643 --ESSKRL----KFNCILTTYEIVLKDKQFLGTLQWAALLVDEAHRLKNDDSLLYKSLKEFDTNH 701
              ||.|.|    |||.::||:|:::.|...|....|...::||||||||.:..|.:.|::.:..|
  Fly  2125 KTESGKVLKEPIKFNVLITTFEMIVTDYMDLKAFNWRLCVIDEAHRLKNRNCKLLEGLRQLNLEH 2189

  Fly   702 RLLITGTPLQNSLKELWALLHFIMPDKFDTWENFEVQHGNAE-DKGYTRLHQQLEPYILRRVKKD 765
            |:|::||||||::.||::||:|:.|.:|.:.|.|..:.|:.. ::...:|...|:|.:|||:|.|
  Fly  2190 RVLLSGTPLQNNISELFSLLNFLEPSQFSSQEEFMSEFGSLRTEEEVNKLQALLKPMMLRRLKDD 2254

  Fly   766 VEKSLPAKVEQILRVEMTSLQKQYYKWILTKNFDALRKGKRGST-STFLNIVIELKKCCNHAALI 829
            |||||..|.|.|:.||:|::||:||:.||.:||..|:||...:. ...:|.::||:|||.|..|:
  Fly  2255 VEKSLAPKEETIIEVELTNIQKKYYRGILEQNFSFLKKGTTSANIPNLMNTMMELRKCCIHPYLL 2319

  Fly   830 RPSEFELM-------GLQQDEALQTLLKGSGKLVLLDKLLCRLKETGHRVLIFSQMVRMLDVLAD 887
            ..:|.::.       |...:...:.|:..:||:||:||||.:||..||||||||||||.||:|.|
  Fly  2320 NGAEEQIQYDFKSQHGEDPESYYKNLILSAGKMVLIDKLLPKLKANGHRVLIFSQMVRCLDILED 2384

  Fly   888 YLQKRHFPFQRLDGSIKGEMRRQALDHFNAEGSQDFCFLLSTRAGGLGINLATADTVIIFDSDWN 952
            ||..|.:||:|:||.|:|.:|::|:|.::..||..|.|||.|:||||||||..||||||:|||||
  Fly  2385 YLVYRKYPFERIDGRIRGNLRQEAIDRYSKPGSDRFVFLLCTKAGGLGINLTAADTVIIYDSDWN 2449

  Fly   953 PQNDLQAQARAHRIGQKNQVNIYRLVTARSVEEQIVERAKQKMVLDHLVIQRMDTTGRTVLDKSG 1017
            ||||||||||.|||||:..|.||||:...:.|.::.::|..|:.||..|:|.|:|.|    .|.|
  Fly  2450 PQNDLQAQARCHRIGQRKMVKIYRLLCRNTYEREMFDKASMKLGLDKAVLQSMNTQG----SKDG 2510

  Fly  1018 NGHSSNSNPFNKDDLSAILKFGAEELFKDEQEHDDDLVC--DIDEILRRAETRNEDPEMPADDLL 1080
                 |:...:|.::..:||.||.....|: ::..|..|  |||.||:|.               
  Fly  2511 -----NNKQLSKKEIEDLLKKGAYGAVMDD-DNAGDKFCEEDIDSILKRR--------------- 2554

  Fly  1081 SAFKVASIAAFEEEPSDSVSKQDQNAAGEE-----DDSKDWD------DIIPEGFRKAIDDQERA 1134
                 ..:...|.|...:.||....|:|..     ||...|.      ||.|:...:        
  Fly  2555 -----TQVITMESEKGSTFSKASFAASGNRSDITIDDPDFWTKWAKKVDIDPDACER-------- 2606

  Fly  1135 KEMEDLYL-PPRRKTAANQNEGKRGAGKGGKGKQQADDSGGDSDYELGSDGSGDDGRPRKRGRPT 1198
            .|.|||.| .|||:|     :.||...:........:.|..:||.|   .|.|...|.||..|..
  Fly  2607 DETEDLVLSEPRRRT-----QIKRYGHEDVMELNSEESSNENSDEE---GGIGLRSRRRKEKRDR 2663

  Fly  1199 MKEK------ITGFTDA--------------------------------------ELRRFIRSYK 1219
            .:||      |....||                                      ||.:|.|.::
  Fly  2664 AREKKGNDEYIPRERDALAALGLEEIQYGNWAKSECFKVEKGLLSFGWGRWSELLELGQFKRGWR 2728

  Fly  1220 KFPAP-------LHRMEAIACDAEL-----------QEKPLAELKRLGEMLHDRCVQFLHEHKEE 1266
            .....       |:.::....|.::           ::..:.::.|....||:...:..:..|..
  Fly  2729 DVDVEDCARIILLYCLQVYKGDEKIKTFIWDLITPTEDGEVQKISRDHSGLHNLVPRGRNGGKSN 2793

  Fly  1267 ESKTAATDETPG------------AKQRRARATFSVKLGGVSFNA-------------------- 1299
            :..|..:...||            |.:..|........||::.:|                    
  Fly  2794 KESTGVSTPAPGSASGSNSGNTTPAHKSSALDGSDKDSGGINASAVAAAVTSIHDPNHWSKKEKY 2858

  Fly  1300 -------------------KKLLACEQELQPLNEIMPSMPEERQQWSFNIKTRAPVFDVD----- 1340
                               |.||.........:|::....::       ||...|:.::.     
  Fly  2859 DADAYLEGAYKKHLGRHANKVLLRVRMLYYIQHEVIGDFVQQ-------IKDNTPISELPIRPPP 2916

  Fly  1341 ---------WG-IEEDTKLLCGIYQYGIGSWEQMKLDPTLKLTDKILLNDTRKPQAKQLQTRAEY 1395
                     |. |..|..||.|.|::|...:.||:.||.|.....:                   
  Fly  2917 TPDQVPSSWWNPICCDKSLLVGTYKHGCEMYRQMRADPNLCFVTHV------------------- 2962

  Fly  1396 LLKIIKKNVELTKGGQRRQRRPRASRANDAKAASQSASSTIDA--KPHDGEDAAGDARTVAESSN 1458
                                  .|..|.|..|.:....:..||  |..||::...|..|..:.|:
  Fly  2963 ----------------------GAGAAGDDLAVTSLPINEDDANSKHDDGDEVDDDGTTTTKDSD 3005

  Fly  1459 SQVDPSTASPHNAPATEQHG--------DPAKKAKKSKARSKKTSASDNNGNKPMHFTANNEPRA 1515
            |              |:..|        ||.:.:...|:.|:..|..::........|..:|   
  Fly  3006 S--------------TKLTGGDNKDSLLDPERPSSSGKSSSENASGGNDKTESENDATTVSE--- 3053

  Fly  1516 LEVLGDLDPSIFNECKEKMRPVKKALKALDQPDVSLSDQDQLQHTRDCLLQIGKQIDVCLNPYAE 1580
                        :..|.::.|.|.:     ..|||::.||.|..|.:               .|.
  Fly  3054 ------------SSYKSEVLPGKGS-----DLDVSVAQQDALSATPE---------------LAN 3086

  Fly  1581 TEKKEWRSNLWYFVSKFTELDAKRLFKIYKHALKQKAGGDGEAKGK---DKGSSGSP---AKSKP 1639
            |...:...|                              |.:....   |...|.||   .|::.
  Fly  3087 TSDPKMNKN------------------------------DAQVSASVSCDPADSSSPEAAGKAQG 3121

  Fly  1640 NGVTTEEKEKERDRSGGKKKKKDKDKERSGQARYPETGIPTSGRYADPPLKRKRDENDADASSGL 1704
            .||.|.: ..|.|....||..:.:.||.:|.|               |.::.|:|      |:.:
  Fly  3122 TGVQTGD-AGELDIESEKKDNEKETKESTGDA---------------PAVEAKKD------SAAI 3164

  Fly  1705 AGAPGGGIGDNLKSM---------------------------SFKRLNMDRHEDRKKHHRGPDYY 1742
            |.|.    ||..:|.                           |.|..|.:...|   |.....:.
  Fly  3165 ARAE----GDKTESCTNNATTNISTTTTTTTITNTTTTTNNPSSKAANSNNTTD---HANSNSHL 3222

  Fly  1743 GGSGPPMGSGSYEGGSNSRRQGPTSPSTPRTGRGGYDPPPAPSGYT------PEMERWQSRDR-- 1799
            |.......:|||                          ||..:...      |.|:...:|.|  
  Fly  3223 GLDEEESVAGSY--------------------------PPTVAAVEDATTMWPSMQDLNTRLRRV 3261

  Fly  1800 ---YSQDYKRDR----------------------------------YDGYGRSGGGQGS 1821
               |.::||::.                                  ..|.|..|.|.||
  Fly  3262 ITAYQRNYKKEELKLQQKAKLQALVSSTPPLSVPTTPTLQSMQMQLQSGSGSGGSGIGS 3320

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Chd1NP_001245851.1 CHROMO 374..422 CDD:237991 15/98 (15%)
Chromo 458..509 CDD:278797 20/59 (34%)
SNF2_N 548..829 CDD:278600 130/289 (45%)
DEXDc 564..709 CDD:238005 69/151 (46%)
Helicase_C 852..967 CDD:278689 78/115 (68%)
DUF4208 1521..1610 CDD:290618 13/89 (15%)
DUF3824 1795..>1894 CDD:289625 11/67 (16%)
kisNP_001137761.1 BASP1 1554..1786 CDD:283191 47/232 (20%)
HepA 1676..2527 CDD:223627 318/905 (35%)
SDA1 <1693..>1854 CDD:283052 35/179 (20%)
CHROMO <1879..1919 CDD:237991 9/40 (23%)
Chromo 1941..1996 CDD:278797 20/59 (34%)
DEXDc 2048..2197 CDD:238005 69/151 (46%)
Helicase_C 2350..2464 CDD:278689 78/114 (68%)
RR_TM4-6 3728..>3877 CDD:283990
BRK 4569..4613 CDD:197800
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C138587940
eggNOG 1 0.900 E2759_KOG0384
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR45623
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.