DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: gammaTub23C and TUBB3

Sequence 1:NP_476804.1 Gene:gammaTub23C FlyBaseID:FBgn0260639 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_006077.2 Gene:TUBB3 HGNCID:20772 Length:450 Species:Homo sapiens

Alignment Length:451 Identity:158/452 (35%)
Similarity:262/452 (58%) Gaps:28/452 (6%)


  Fly     4 EIITLQLGQCGNQIGFEFWKRLCLEHGISPSGVLEDFANDG---LDRKDVFFYQADDDHYIPRAV 65
            ||:.:|.||||||||.:||:.:..||||.|||   ::..|.   |:|..|::.:|....|:|||:
Human     3 EIVHIQAGQCGNQIGAKFWEVISDEHGIDPSG---NYVGDSDLQLERISVYYNEASSHKYVPRAI 64

  Fly    66 LLDLEPRVINTIMGSVYSKLYNPENVYLSKHGGGAGNNWASG-YSQGEKLQEEVFDIIDREADGS 129
            |:||||..::::....:..|:.|:|....:  .|||||||.| |::|.:|.:.|.|::.:|.:..
Human    65 LVDLEPGTMDSVRSGAFGHLFRPDNFIFGQ--SGAGNNWAKGHYTEGAELVDSVLDVVRKECENC 127

  Fly   130 DSLEGFILCHSIAGGTGSGMGSFIMERLADRYPKKLIQTFSVFPNQDEISDVVVQPYNSMLTLKR 194
            |.|:||.|.||:.||||||||:.::.::.:.||.:::.||||.|: .::||.||:|||:.|::.:
Human   128 DCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPS-PKVSDTVVEPYNATLSIHQ 191

  Fly   195 LTTAADSVVVLDNTALNRIACDRLHIQNPSFSQINNLVSTIMSVSTTTLRYPSYMNNNLIGLTAP 259
            |....|....:||.||..|....|.:..|::..:|:|||..||..||:||:|..:|.:|..|...
Human   192 LVENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVN 256

  Fly   260 LIPTPQLHFLMTGYTPLTSDSDIHTQQLVNVRKTTVLDVMRRLLQPKNMMVSTGPDKSNHHCYIS 324
            ::|.|:|||.|.|:.|||:..   :||   .|..||.::.:::...||||.:..|   .|..|::
Human   257 MVPFPRLHFFMPGFAPLTARG---SQQ---YRALTVPELTQQMFDAKNMMAACDP---RHGRYLT 312

  Fly   325 ILNIIQGEVDPTQVHKSLQRIRDRKMAQFIPWGPTSIQVALSRSSPYVQSNHRVSGLMLANHTSI 389
            :..:.:|.:...:|.:.:..|:.:..:.|:.|.|.:::||:....|   ...::|...:.|.|:|
Human   313 VATVFRGRMSMKEVDEQMLAIQSKNSSYFVEWIPNNVKVAVCDIPP---RGLKMSSTFIGNSTAI 374

  Fly   390 CSLFERALNQYDKLRKRGAFLDQFRREDIFKDDLNELDESRETVDCLV---QEYEAATRED 447
            ..||:|...|:..:.:|.|||..:..|.:   |..|..|:...::.||   |:|:.||.|:
Human   375 QELFKRISEQFTAMFRRKAFLHWYTGEGM---DEMEFTEAESNMNDLVSEYQQYQDATAEE 432

Known Domains:


GeneSequenceDomainRegion External IDIdentity
gammaTub23CNP_476804.1 PLN00222 1..451 CDD:215108 158/452 (35%)
gamma_tubulin 4..440 CDD:276957 154/443 (35%)
TUBB3NP_006077.2 PLN00220 1..447 CDD:215107 158/452 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5023
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.