DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RpS21 and RPS21B

Sequence 1:NP_001259970.1 Gene:RpS21 FlyBaseID:FBgn0015521 Length:83 Species:Drosophila melanogaster
Sequence 2:NP_012399.1 Gene:RPS21B SGDID:S000003672 Length:87 Species:Saccharomyces cerevisiae

Alignment Length:83 Identity:49/84 (58%)
Similarity:61/84 (73%) Gaps:3/84 (4%)


  Fly     1 MENDAGENVDLYVPRKCSASNRIIHAKDHASVQLSIVDVDPETGRQTDGSK-TYAICGEIRRMGE 64
            ||||.|:.|:|||||||||:||||.|.||||||:::..|| |.||...|.. |||:.|.:|..||
Yeast     1 MENDKGQLVELYVPRKCSATNRIIKADDHASVQINVAKVD-EEGRAIPGEYITYALSGYVRSRGE 64

  Fly    65 SDDCIVRLAKKDGIITKN 82
            |||.:.|||:.||:: ||
Yeast    65 SDDSLNRLAQNDGLL-KN 81

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RpS21NP_001259970.1 Ribosomal_S21e 1..77 CDD:279574 46/77 (60%)
RPS21BNP_012399.1 Ribosomal_S21e 1..80 CDD:307419 47/81 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C226523237
eggNOG 1 0.900 E1_KOG3486
Hieranoid 1 1.000
Homologene 1 1.000 H90915
Inparanoid 1 1.050 91 1.000 Inparanoid score I1511
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003483
OrthoInspector 1 1.000 T634497
orthoMCL 1 0.900 OOG5_127484
Panther 1 1.100 LDO PTHR10442
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1237
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.