DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RpS21 and rps21

Sequence 1:NP_001259970.1 Gene:RpS21 FlyBaseID:FBgn0015521 Length:83 Species:Drosophila melanogaster
Sequence 2:NP_001005126.1 Gene:rps21 XenbaseID:XB-GENE-1007930 Length:83 Species:Xenopus tropicalis

Alignment Length:83 Identity:61/84 (73%)
Similarity:69/84 (82%) Gaps:0/84 (0%)


  Fly     1 MENDAGENVDLYVPRKCSASNRIIHAKDHASVQLSIVDVDPETGRQTDGSKTYAICGEIRRMGES 65
            |:|||||.||||||||||||||||.||||||:|::|.:||..|||.....|||||||.|||||||
 Frog     1 MQNDAGEFVDLYVPRKCSASNRIIGAKDHASIQINIAEVDKVTGRFNSQYKTYAICGAIRRMGES 65

  Fly    66 DDCIVRLAKKDGIITKNF 83
            ||.|:||||.|.|::|||
 Frog    66 DDSILRLAKNDCIVSKNF 83

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RpS21NP_001259970.1 Ribosomal_S21e 1..77 CDD:279574 57/76 (75%)
rps21NP_001005126.1 Ribosomal_S21e 1..76 CDD:279574 56/75 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C226506546
eggNOG 1 0.900 E1_KOG3486
Hieranoid 1 1.000
Homologene 1 1.000 H90915
Inparanoid 1 1.050 124 1.000 Inparanoid score I4446
OMA 1 1.010
OrthoDB 1 1.010 D1571849at2759
OrthoFinder 1 1.000 FOG0003483
OrthoInspector 1 1.000 T1058598
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1237
TreeFam 1 0.960
1211.800

Return to query results.
Submit another query.