DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS21 and rps21

DIOPT Version :10

Sequence 1:NP_722853.1 Gene:RpS21 / 33487 FlyBaseID:FBgn0015521 Length:83 Species:Drosophila melanogaster
Sequence 2:NP_957485.1 Gene:rps21 / 394166 ZFINID:ZDB-GENE-040426-1102 Length:81 Species:Danio rerio


Alignment Length:81 Identity:57/81 - (70%)
Similarity:66/81 - (81%) Gaps:0/81 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MENDAGENVDLYVPRKCSASNRIIHAKDHASVQLSIVDVDPETGRQTDGSKTYAICGEIRRMGES 65
            |:|||||.||||||||||||||||.||||||:|::|.:||..|||.....|||||||.||||||:
Zfish     1 MQNDAGEFVDLYVPRKCSASNRIIGAKDHASIQINIAEVDRVTGRFNGQFKTYAICGAIRRMGEA 65

  Fly    66 DDCIVRLAKKDGIITK 81
            ||.::||||.|.|:.|
Zfish    66 DDSLLRLAKTDSIVAK 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS21NP_722853.1 Ribosomal_S21e 1..79 CDD:460133 55/77 (71%)
rps21NP_957485.1 Ribosomal_S21e 1..79 CDD:460133 55/77 (71%)

Return to query results.
Submit another query.