DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS21 and rps21

DIOPT Version :10

Sequence 1:NP_722853.1 Gene:RpS21 / 33487 FlyBaseID:FBgn0015521 Length:83 Species:Drosophila melanogaster
Sequence 2:NP_595852.1 Gene:rps21 / 2540806 PomBaseID:SPBC18E5.06 Length:87 Species:Schizosaccharomyces pombe


Alignment Length:80 Identity:53/80 - (66%)
Similarity:63/80 - (78%) Gaps:2/80 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MENDAGENVDLYVPRKCSASNRIIHAKDHASVQLSIVDVDPETGRQTDGSK-TYAICGEIRRMGE 64
            |||:||:.|||||||||||:||||.||||||||:::..||.| |||..|.| ||||.|.:|..||
pombe     1 MENEAGQLVDLYVPRKCSATNRIIQAKDHASVQINVCAVDAE-GRQIPGEKTTYAISGFVRSKGE 64

  Fly    65 SDDCIVRLAKKDGII 79
            |||||.||..:||::
pombe    65 SDDCINRLTTQDGLL 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS21NP_722853.1 Ribosomal_S21e 1..79 CDD:460133 53/78 (68%)
rps21NP_595852.1 Ribosomal_S21e 1..80 CDD:460133 53/80 (66%)

Return to query results.
Submit another query.