DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RpS21 and rps-21

Sequence 1:NP_001259970.1 Gene:RpS21 FlyBaseID:FBgn0015521 Length:83 Species:Drosophila melanogaster
Sequence 2:NP_498579.2 Gene:rps-21 WormBaseID:WBGene00004490 Length:88 Species:Caenorhabditis elegans

Alignment Length:83 Identity:58/84 (69%)
Similarity:69/84 (82%) Gaps:1/84 (1%)


  Fly     1 MENDAGENVDLYVPRKCSASNRIIHAKDHASVQLSIVDVDPETGRQTDGSKT-YAICGEIRRMGE 64
            |:||||:.|:||||||||:|||||..|||||||:..|||||||||...|..| |||||.||||||
 Worm     1 MQNDAGQTVELYVPRKCSSSNRIIGPKDHASVQIDFVDVDPETGRMIPGKSTRYAICGAIRRMGE 65

  Fly    65 SDDCIVRLAKKDGIITKN 82
            |||.|:|||:|||::.::
 Worm    66 SDDAILRLAQKDGLVPRD 83

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RpS21NP_001259970.1 Ribosomal_S21e 1..77 CDD:279574 57/77 (74%)
rps-21NP_498579.2 Ribosomal_S21e 1..78 CDD:279574 57/77 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C226496415
eggNOG 1 0.900 E1_KOG3486
Hieranoid 1 1.000
Homologene 1 1.000 H90915
Inparanoid 1 1.050 122 1.000 Inparanoid score I3282
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1571849at2759
OrthoFinder 1 1.000 FOG0003483
OrthoInspector 1 1.000 T476127
orthoMCL 1 0.900 OOG5_127484
Panther 1 1.100 LDO PTHR10442
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1237
TreeFam 00.000 Not matched by this tool.
1312.840

Return to query results.
Submit another query.