DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2975 and C1galt1

Sequence 1:NP_608719.1 Gene:CG2975 FlyBaseID:FBgn0031468 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_443719.3 Gene:C1galt1 MGIID:2151071 Length:363 Species:Mus musculus

Alignment Length:373 Identity:139/374 (37%)
Similarity:198/374 (53%) Gaps:47/374 (13%)


  Fly    14 LMLLIGLAWGILL-SELMKRTRWQNHADRLKEESSPFPSSQRSRNLRTPPTIAPSTTNPPPDI-- 75
            |:.|.|.|.|..| |:|:        :..|:||::..|:.     |...|....|..|....:  
Mouse    10 LVFLCGSAIGFFLCSQLL--------SILLREEAAIQPNM-----LHNDPHARHSDDNGHSHLKG 61

  Fly    76 -----------------LAARLFNETRVLCMVLTSPKTHHTRAIHIKRTWGRRCNKLIFMSTKAD 123
                             :|..|:.:.::||.|:|||:....:|.|:|.||.:||||::|||::.:
Mouse    62 QMNFNADSSQHKDENIDVAENLYQKVKILCWVMTSPQNLEKKAKHVKATWAQRCNKVLFMSSEEN 126

  Fly   124 KELGSVALNVREGYSNLWPKTRAALQYVYKHHFQKYDWFLKADDDTYFIMENLRAFLHAHNFREP 188
            ::..:|.|..:||...|:.||..|.|||:.|:.:..|||:|||||||.|::|||..|..:|..:|
Mouse   127 QDFPTVGLKTKEGREQLYWKTIKAFQYVHDHYLEDADWFMKADDDTYVIVDNLRWLLSKYNPEQP 191

  Fly   189 VYFGNKFRQHVKEGYMSGGAGYVLSKMALHRLIKLGFSNSSICTNRNYGYEDVELGRCLAGVGVV 253
            :|||.:|:.:||:|||||||||||||.||.|.:. .|.... ||:.: ..||:.||||:..:.|.
Mouse   192 IYFGRRFKPYVKQGYMSGGAGYVLSKEALRRFVN-AFKTEK-CTHSS-SIEDLALGRCMEIINVE 253

  Fly   254 GGDSRDEQGLSRFIPFSPLH----WYPQPPDWYQPLLYYTSPDNSSDCCSNTAISFHYNNAQEFY 314
            .|||||..|...|.||.|.|    .|.....||....|| .|.....|||:.|:||||.:....|
Mouse   254 AGDSRDTIGKETFHPFVPEHHLIKGYLPKTFWYWNYNYY-PPIEGPGCCSDIAVSFHYVDGTTMY 317

  Fly   315 VLEYIIYKLRIFG-INRELGPLPKKKASSRPMSINLQTTKEENGHIAL 361
            .|||::|.||.:| :.|....||:....    .|| |..::|:..|.|
Mouse   318 ELEYLVYHLRPYGYLYRYQPALPENILK----EIN-QVNRKEDTKIKL 360

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2975NP_608719.1 Galactosyl_T 90..>214 CDD:304462 63/124 (51%)
C1galt1NP_443719.3 Galactosyl_T 107..>248 CDD:304462 70/144 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_130429
Panther 1 1.100 O PTHR23033
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.860

Return to query results.
Submit another query.