DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2975 and AT1G33250

DIOPT Version :9

Sequence 1:NP_608719.1 Gene:CG2975 / 33481 FlyBaseID:FBgn0031468 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_174595.1 Gene:AT1G33250 / 840219 AraportID:AT1G33250 Length:548 Species:Arabidopsis thaliana


Alignment Length:332 Identity:81/332 - (24%)
Similarity:121/332 - (36%) Gaps:77/332 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VRPNR-KRLELML-----MLLIGLAW-GILLSELMKRTRWQNHADRLKE-ESSPFPSSQRSRNLR 59
            :||.| .|....|     :||..:|| .::.|....|. |.    .||: |.:...:.:....:.
plant    35 IRPCRLSRFATALVATSALLLASVAWLSLVFSPTTSRC-WH----LLKDWEDNHLWNKRYHHPIV 94

  Fly    60 TPPTIAPSTTNPPPDILAARLFN---ETRVLCMV--LTSPKTHHTRAI-HIKRTWGRRCNKLIFM 118
            |||...||    ||.:.|..||:   ..|.|..:  |.....|....| ...:.|.|| .:|:.:
plant    95 TPPPPPPS----PPSLPALPLFDHEFRNRSLSEIDKLDLSMNHLMFGIAGSSQLWERR-KELVRL 154

  Fly   119 STKADKELGSVAL----NVREGYSNLWP-----------------------KTRAALQYVYKHHF 156
            ..|..:..|.|.|    :..||..:|.|                       .:|.|:: .::...
plant   155 WWKPSQMRGHVWLEEQVSPEEGDDSLPPIIVSEDSSRFRYTNPTGHPSGLRISRIAME-SFRLSL 218

  Fly   157 QKYDWFLKADDDTYFIMENLRAFLHAHNFREPVYFGNKFRQHVKEGYMS-----GGAGYVLSKMA 216
            ....||:..||||.|.:.||.|.|..::..|.||.||....|....|.|     ||.|..:|...
plant   219 PNVRWFVLGDDDTIFNVHNLLAVLSKYDPSEMVYIGNPSESHSANSYFSHNMAFGGGGIAISYPL 283

  Fly   217 LHRLIKLGFSNSSICTNRN---YGYEDVELGRCLAGVGV------------VGGDSRDEQGLSRF 266
            ...|.::    ...|.:|.   ||.:| .|..|:..:||            :.|::.........
plant   284 AEALSRI----HDDCLDRYPKLYGSDD-RLHACITELGVPLSREPGFHQWDIKGNAHGLLSSHPI 343

  Fly   267 IPFSPLH 273
            .||..:|
plant   344 APFVSIH 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2975NP_608719.1 Galactosyl_T 90..>214 CDD:304462 39/158 (25%)
AT1G33250NP_174595.1 Galactosyl_T 17..548 CDD:304462 81/332 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.