DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2975 and b3glct

Sequence 1:NP_608719.1 Gene:CG2975 FlyBaseID:FBgn0031468 Length:385 Species:Drosophila melanogaster
Sequence 2:XP_012812732.1 Gene:b3glct XenbaseID:XB-GENE-951583 Length:530 Species:Xenopus tropicalis

Alignment Length:246 Identity:62/247 (25%)
Similarity:100/247 (40%) Gaps:49/247 (20%)


  Fly    78 ARLFNETRVLC-----------MVLTSPKTHHTRAIHIKRTWGRRCNKLIFMSTKADKELGSVAL 131
            |..||....:|           .:.|..|.|..|...:|:||.::.....:.|..||..:.:..|
 Frog   284 ATAFNSALPVCGSPVQKEDMFVAIKTCRKFHKDRVPVVKKTWEKQATHYEYYSDYADNTIPTADL 348

  Fly   132 ---NVREGYSNLWPKTRAALQYVYKHHFQKYDWFLKADDDTYFIMENLRAFLHAHNFREPVYFGN 193
               ||..|:..   ||.|.|:...:.:..:..|.:..||||...:..|:..|..:|..:.|:.|.
 Frog   349 RIPNVERGHCG---KTFAILERFMELYVGRMSWLIIVDDDTLISLPRLQKLLGCYNPHQAVFLGE 410

  Fly   194 KFRQHVKEG---YMSGGAGYVLSKMALHRLIKLGFSNSSICTNRNYGYEDVELGRCLAGVGVVGG 255
            ::...::.|   |::||.|.|.|:.|:.||:     ||......|...:|:.||.|.:.:|:.  
 Frog   411 RYGYGLQAGGYNYITGGGGMVFSREAVRRLM-----NSKCRCYSNDAPDDMVLGMCFSSLGIT-- 468

  Fly   256 DSRDEQGLSRFIPFSPLHWYPQPPDWYQPLLYYTSPDNSSDCCSNTAISFH 306
                       |..|||....:|.|:.:..|.:..|           ||||
 Frog   469 -----------ITHSPLFHQARPTDYAKDYLAHQIP-----------ISFH 497

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2975NP_608719.1 Galactosyl_T 90..>214 CDD:304462 35/130 (27%)
b3glctXP_012812732.1 Fringe 298..501 CDD:190308 58/233 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.