DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2975 and C1GALT1C1L

Sequence 1:NP_608719.1 Gene:CG2975 FlyBaseID:FBgn0031468 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001094800.1 Gene:C1GALT1C1L HGNCID:51617 Length:315 Species:Homo sapiens

Alignment Length:337 Identity:89/338 (26%)
Similarity:145/338 (43%) Gaps:56/338 (17%)


  Fly    15 MLLIGLAWGILLS-----ELMKRTRWQNHADRLKEESSPFPSSQRSRNLRTPPTIAPSTTNPPPD 74
            |||..::| :|::     .:..|.:.|:|               ...:||.|.......|:   .
Human    13 MLLGSISW-VLITMFGQIHIRHRGQTQDH---------------EHHHLRPPNRNDFLNTS---K 58

  Fly    75 ILAARLFNETRVLCMVLTSPKTHHTRAIHIKRTWGRRCNKLIFMSTKADKELGSVALNVREGYSN 139
            ::...|....||.|::....:.....|: :|.||.:.|:|.....||.| .|.::..|.|     
Human    59 VILLELSKSIRVFCIIFGESEDESYWAV-LKETWTKHCDKAELYDTKND-NLFNIESNDR----- 116

  Fly   140 LWPKTRAALQYVYKHHFQKYDWFLKADDDTYFIMENLRAFLHAHNFREPVYFGNKFRQHVKEG-- 202
             |.:.|.|.:||::.:...|:||..|...|:.::|||:..|...:..:|.|.|:.    |..|  
Human   117 -WVQMRTAYKYVFEKYGDNYNWFFLALPTTFAVIENLKYLLFTRDASQPFYLGHT----VIFGDL 176

  Fly   203 -YMSGGAGYVLSKMALHRLIKLGFSNSSICTNRNYGY---EDVELGRCLAGVGVVGGDSRDEQGL 263
             |::...|.|||:..:.||.:| ..||..|.:::..:   ||.:|..||...||...::.|.:|.
Human   177 EYVTVEGGIVLSRELMKRLNRL-LDNSETCADQSVIWKLSEDKQLAICLKYAGVHAENAEDYEGR 240

  Fly   264 SRF--IPFSPLHWYPQPPDWYQPLLYYTSPDNSSDCCSNTAISFHYNNAQEFYVLEYIIYKLRIF 326
            ..|  .|.:.|         .:..|..........|||:.||:|:....|:..|:.|.:|:||.|
Human   241 DVFNTKPIAQL---------IEEALSNNPQQVVEGCCSDMAITFNGLTPQKMEVMMYGLYRLRAF 296

  Fly   327 G--INRELGPLP 336
            |  .|..|..||
Human   297 GHYFNDTLVFLP 308

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2975NP_608719.1 Galactosyl_T 90..>214 CDD:304462 36/127 (28%)
C1GALT1C1LNP_001094800.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23033
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.