DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2975 and C1galt1

Sequence 1:NP_608719.1 Gene:CG2975 FlyBaseID:FBgn0031468 Length:385 Species:Drosophila melanogaster
Sequence 2:XP_006236153.1 Gene:C1galt1 RGDID:621105 Length:390 Species:Rattus norvegicus

Alignment Length:291 Identity:126/292 (43%)
Similarity:174/292 (60%) Gaps:14/292 (5%)


  Fly    76 LAARLFNETRVLCMVLTSPKTHHTRAIHIKRTWGRRCNKLIFMSTKADKELGSVALNVREGYSNL 140
            :|..|:.:.:|||.|:|||:....:|.|:|.||.:||||::|||::.:|:..:|.|..:||...|
  Rat   106 VAENLYQKVKVLCWVMTSPQNLEKKAKHVKATWAQRCNKVLFMSSEENKDFPTVGLETKEGREQL 170

  Fly   141 WPKTRAALQYVYKHHFQKYDWFLKADDDTYFIMENLRAFLHAHNFREPVYFGNKFRQHVKEGYMS 205
            :.||..|.|||:.|:.:..|||:|||||||.|::|||..|..:|..:|:|||.:|:.:||:||||
  Rat   171 YWKTIKAFQYVHDHYLEDADWFMKADDDTYVILDNLRWLLSKYNPEQPIYFGRRFKPYVKQGYMS 235

  Fly   206 GGAGYVLSKMALHRLIKLGFSNSSICTNRNYGYEDVELGRCLAGVGVVGGDSRDEQGLSRFIPFS 270
            |||||||||.||.|.:. .|.... ||:.: ..||:.||||:..:.|..|||||..|...|.||.
  Rat   236 GGAGYVLSKEALRRFVD-AFKTEK-CTHSS-SIEDLALGRCMEIIKVEAGDSRDPTGKETFHPFV 297

  Fly   271 PLH----WYPQPPDWYQPLLYYTSPDNSSDCCSNTAISFHYNNAQEFYVLEYIIYKLRIFG-INR 330
            |.|    .|.....||....|| .|.....|||:.|:||||.::...|.|||::|.||.:| :.|
  Rat   298 PEHHLIKGYLPKTFWYWNYNYY-PPVEGPGCCSDIAVSFHYVDSTTMYELEYLVYHLRPYGYLYR 361

  Fly   331 ELGPLPKKKASSRPMSINLQTTKEENGHIAL 361
            ....||:....    .|| |..|:|:..|.|
  Rat   362 YQPALPENILK----EIN-QVNKKEDTKIKL 387

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2975NP_608719.1 Galactosyl_T 90..>214 CDD:304462 64/124 (52%)
C1galt1XP_006236153.1 Galactosyl_T 134..>275 CDD:304462 71/144 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_130429
Panther 1 1.100 O PTHR23033
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
54.870

Return to query results.
Submit another query.