DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2975 and CG34452

Sequence 1:NP_608719.1 Gene:CG2975 FlyBaseID:FBgn0031468 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001097611.2 Gene:CG34452 FlyBaseID:FBgn0085481 Length:318 Species:Drosophila melanogaster

Alignment Length:286 Identity:101/287 (35%)
Similarity:143/287 (50%) Gaps:24/287 (8%)


  Fly    56 RNLRTPPTIAPSTTNPPPDILAARLFNETRVLCMVLTSPKTHHTRAIHIKRTWGRRCNKLIFMST 120
            ||.::...:  .:..|||          .|:.|::.|....|...||||.|||.|.|:..:|:|.
  Fly    36 RNFKSREVV--ESYGPPP----------ARIFCIISTYAYRHGHAAIHIHRTWVRHCDHYLFVSD 88

  Fly   121 KADKEL-GSVALNVREGYSNLWPKTRAALQYVYKHHFQKYDWFLKADDDTYFIMENLRAFLHAHN 184
            ..|..| .:|.:|:    .:.|.:.||.|:||||:||.:.||||..:||.:.:::|||..|..::
  Fly    89 DIDNHLEPAVFMNM----PDKWHRMRAYLEYVYKYHFHQGDWFLYCNDDNFVVVDNLRHMLKTYS 149

  Fly   185 FREPVYFGNKFRQHVKEGYMSGGAGYVLSKMALHRLIKLGFSNSSICTNRNYGYE-DVELGRCLA 248
            .:|.:|||.|.|......:|..|:|.|.|..||.|......:|.|||::...|.: ..||||||.
  Fly   150 PKELIYFGCKLRTTNGLVFMLEGSGIVFSAAALKRFALTALTNESICSSETKGNDFTKELGRCLT 214

  Fly   249 GVGVVGGDSRDEQGLSRFIPF-SPLHWYPQPPDWYQPLLYYTS----PDNSSDC-CSNTAISFHY 307
            .|.|:.||||||....||:|| :.||......:..:...|:..    |.|..:. .|..:|.||.
  Fly   215 NVNVIAGDSRDEFQRHRFLPFDADLHLGSSMNESLENHKYFLDHSYYPVNDMNLPVSLHSICFHV 279

  Fly   308 NNAQEFYVLEYIIYKLRIFGINRELG 333
            ......|.|.|..||.||||:...||
  Fly   280 PYTLNIYDLYYFAYKTRIFGVPLNLG 305

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2975NP_608719.1 Galactosyl_T 90..>214 CDD:304462 48/125 (38%)
CG34452NP_001097611.2 Galactosyl_T 72..>183 CDD:304462 45/115 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C88690462
eggNOG 1 0.900 E1_KOG2246
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23033
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.