DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2975 and si:dkey-202e17.1

Sequence 1:NP_608719.1 Gene:CG2975 FlyBaseID:FBgn0031468 Length:385 Species:Drosophila melanogaster
Sequence 2:XP_005170092.1 Gene:si:dkey-202e17.1 ZFINID:ZDB-GENE-060503-810 Length:316 Species:Danio rerio

Alignment Length:332 Identity:132/333 (40%)
Similarity:185/333 (56%) Gaps:26/333 (8%)


  Fly     8 KRLELMLMLLIGLAWGILLSELMKRTRWQNHADRLKEESSPFPSSQRSRNLRTPPTIAPSTTNPP 72
            :|.:...:.|.|:|..|.|      |...:|..  |..:|.|  .:.:||:.|.........|..
Zfish     2 RRFKQNFLFLSGVAVSIFL------TITYSHVQ--KTRTSSF--VRIARNISTVKHTVAQNRNAT 56

  Fly    73 PDILAARLFNETRVLCMVLTSPKTHHTRAIHIKRTWGRRCNKLIFMSTKADKELGSVALNVREGY 137
            .|     ...:.||||.|:|.|:...:|..|:..|||:||:.:::|::| :.:..::.|||.||.
Zfish    57 LD-----SSQKVRVLCWVMTQPQNLQSRTQHVHATWGKRCDTILYMTSK-NTDFPTIGLNVSEGR 115

  Fly   138 SNLWPKTRAALQYVYKHHFQKYDWFLKADDDTYFIMENLRAFLHAHNFREPVYFGNKFRQHVKEG 202
            :.|:.||..|.||::|||....||||||||||:.::||||..|..|:..:|:|||.:||..|.:|
Zfish   116 NQLYWKTIRAFQYIHKHHLDDADWFLKADDDTFVVIENLRHSLSKHSSEDPLYFGRRFRPFVAQG 180

  Fly   203 YMSGGAGYVLSKMALHRLIKLGFSNSSICTNRNYGYEDVELGRCLAGVGVVGGDSRDEQGLSRFI 267
            ||||||||||||.||.|.:| ||:: .:||:.. ..|||.:|:|:..:.|..|||||..|...|.
Zfish   181 YMSGGAGYVLSKEALRRFVK-GFAD-GLCTHTT-ELEDVGMGQCMEKMKVEMGDSRDVFGRQVFH 242

  Fly   268 PFSPLHWY-----PQPPDWYQPLLYYTSPDNSSDCCSNTAISFHYNNAQEFYVLEYIIYKLRIFG 327
            |:.|.::.     .|.| ||....:|| |.....|||:.||||||.||.|.:.|||..|.||.:|
Zfish   243 PYPPGNYLVRQLRRQRP-WYLIYDHYT-PVEGPGCCSDFAISFHYINAVEMHTLEYYTYHLRPYG 305

  Fly   328 INRELGP 334
            ......|
Zfish   306 YKYRFNP 312

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2975NP_608719.1 Galactosyl_T 90..>214 CDD:304462 61/124 (49%)
si:dkey-202e17.1XP_005170092.1 Galactosyl_T <139..>229 CDD:304462 49/93 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C158952969
eggNOG 1 0.900 E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_130429
Panther 1 1.100 O PTHR23033
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.