DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2975 and T09E11.12

Sequence 1:NP_608719.1 Gene:CG2975 FlyBaseID:FBgn0031468 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001076611.1 Gene:T09E11.12 WormBaseID:WBGene00045103 Length:323 Species:Caenorhabditis elegans

Alignment Length:283 Identity:92/284 (32%)
Similarity:140/284 (49%) Gaps:37/284 (13%)


  Fly    77 AARLFNETRVLCMVLTSPKTHHTRAIHIKRTWGRRCNKLIFMSTKADKEL----GSVALNVREGY 137
            |.||.|..::.|.|.||.:....|...|..||.|||:...|.|......|    .:|..|:.:.|
 Worm    71 ALRLPNTGQLFCFVETSERYMDERVPSIASTWLRRCDNGRFFSKTPLLNLNITYSTVYKNLEDSY 135

  Fly   138 SNLWPKTRAALQYVYKHHFQKYDWFLKADDDTYFIMENLRAFLHAHNFREPVYFGNKFRQHVKEG 202
            |:|:.|:.....|.|.|..:.:||:|||||||||.|::||.:|:..:..:|:|.|      .|.|
 Worm   136 SDLFRKSIFGFYYSYVHISKSFDWYLKADDDTYFAMDHLREYLNTLDPSKPLYLG------YKNG 194

  Fly   203 YMSGGAGYVLSKMALHRLIKLGFSNSSICTNRNYGY-EDVELGRCLAGVGVVGGDSRDEQGLSRF 266
            |.|||:||:||..|:...::..:.:...|.   |.: ||..:|||||.||:...|:||::||:.|
 Worm   195 YNSGGSGYILSNAAVKLFVEKSYHDEYGCP---YDWAEDHGIGRCLARVGIYPTDTRDDKGLNSF 256

  Fly   267 IPFSPLHWYPQPPDW-YQPLLYYTSPDNSSDCCSNTAISFHYNNAQEFYVLEYIIYKLRIFGINR 330
            :||.|.......||| :.|.:.:         .|...:|.|........||:.|::.        
 Worm   257 VPFKPSELAEFGPDWHFYPAVQF---------ASQKFVSLHRLPPAMMLVLDEILHP-------- 304

  Fly   331 ELGPLPKKKASSRPMSINLQTTK 353
            :||     :..:.|:.:||.:.|
 Worm   305 KLG-----RNDTNPIVVNLDSFK 322

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2975NP_608719.1 Galactosyl_T 90..>214 CDD:304462 50/128 (39%)
T09E11.12NP_001076611.1 Galactosyl_T <130..246 CDD:304462 48/125 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C88701532
eggNOG 1 0.900 E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D555141at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23033
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.900

Return to query results.
Submit another query.