DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2975 and b3gnt5

DIOPT Version :9

Sequence 1:NP_608719.1 Gene:CG2975 / 33481 FlyBaseID:FBgn0031468 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_989240.1 Gene:b3gnt5 / 394849 XenbaseID:XB-GENE-955708 Length:377 Species:Xenopus tropicalis


Alignment Length:221 Identity:47/221 - (21%)
Similarity:84/221 - (38%) Gaps:67/221 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 VLCMVLTSPKTHHTRAIHIKRTWGRR--------CN-KLIF-MSTKAD--------KEL------ 126
            :|..|.|||:....|.. |::|||..        .| |::| :..:||        |:|      
 Frog    89 LLLFVKTSPENRRRRNA-IRKTWGNEDYIRSQYAANIKVVFALGIEADPVKSHQTQKDLVIENKR 152

  Fly   127 --GSVALNVREGYSNLWPKTRAALQYVYKHHF-QKYDWFLKADDDTYFIMENLRAFL-------- 180
              ..:..:.::.:.||  ..:..||:.:.:.: ....:.:.||||.:....||.::|        
 Frog   153 FNDLIQQDFKDTFHNL--TLKLLLQFGWVNSYCPSAKFIMSADDDIFVHTPNLVSYLKSLPIETQ 215

  Fly   181 -----HAHNFREPVYFGNKFRQHVKEGYM-------------SGGAGYVLSKMALHRLIKLGFSN 227
                 ..|....|:      |....:.|:             :.||.||:||....::.:     
 Frog   216 DFWIGRVHRGSPPI------RSKTSKYYVPYEMYPWSSYPDYTAGAAYVVSKDVAAKVYE----- 269

  Fly   228 SSICTNRNYGYEDVELGRCLAGVGVV 253
            :|...|.:...:||.:|.|...:|||
 Frog   270 ASQTLNTSLYIDDVFMGICANKMGVV 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2975NP_608719.1 Galactosyl_T 90..>214 CDD:304462 35/176 (20%)
b3gnt5NP_989240.1 Galactosyl_T 101..297 CDD:389837 42/209 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.