DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2975 and CG34057

Sequence 1:NP_608719.1 Gene:CG2975 FlyBaseID:FBgn0031468 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001033980.2 Gene:CG34057 FlyBaseID:FBgn0054057 Length:355 Species:Drosophila melanogaster

Alignment Length:345 Identity:139/346 (40%)
Similarity:201/346 (58%) Gaps:32/346 (9%)


  Fly    13 MLMLLIGLAWGILLSELMKRTR-WQNHADRLKEESS----PFPSSQRSRNLRTPPTIAPSTTNPP 72
            ::.|::|:..||.|::.:...: |:|:..|..|:::    |..|.:.                  
  Fly    25 IIFLVLGIMLGIRLTDFIGYLKLWRNNDLRASEKAALLKYPVASEEH------------------ 71

  Fly    73 PDILAARLFNETRVLCMVLTSPKTHHTRAIHIKRTWGRRCNKLIFMSTKADKELGSVALNVREGY 137
               ||..|..|.|:||:|||.|.:|.|:|..:.||||.|||||||||::.|..|..:.:|..|..
  Fly    72 ---LATWLRREVRILCLVLTMPSSHATKAALVNRTWGARCNKLIFMSSQTDSNLNILQINKSESR 133

  Fly   138 SNLWPKTRAALQYVYKHHFQKYDWFLKADDDTYFIMENLRAFLHAHNFREPVYFGNKFRQHVKEG 202
            .||:.|.|..:.||:||:..:||||||||||||.:|||||.||:.::....||||.:|:.:..:|
  Fly   134 KNLYAKVRTGMAYVHKHYLNEYDWFLKADDDTYIVMENLRLFLYPYDPESSVYFGCRFKAYFSQG 198

  Fly   203 YMSGGAGYVLSKMALHRLIKLGFSNSSICTNRNYGYEDVELGRCLAGVGVVGGDSRDEQGLSRFI 267
            |||||.|||||:.||.||.....::::|| ..|...|||::|.||..|||:.||:||.||..||:
  Fly   199 YMSGGGGYVLSRDALRRLNLFALNSTTIC-KLNGESEDVQIGHCLQDVGVIAGDTRDFQGHHRFL 262

  Fly   268 PFSPLHWYPQ--PPDWYQPLLYYTSPDNSSDCCSNTAISFHYNNAQEFYVLEYIIYKLRIFGINR 330
            |.:|...:|.  ...|.:.  |:....|.||||:.:||||||....||.:.|:.:|.:|:||::|
  Fly   263 PVNPFTVFPTILSNSWLEG--YFFHKPNKSDCCAASAISFHYVKDFEFELFEFFLYYMRVFGLHR 325

  Fly   331 ELGPLPKKKASSRPMSINLQ 350
            ....|| .:...|.|:..||
  Fly   326 TPRALP-SRLGFRQMNERLQ 344

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2975NP_608719.1 Galactosyl_T 90..>214 CDD:304462 67/124 (54%)
CG34057NP_001033980.2 Galactosyl_T 93..>243 CDD:304462 76/151 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C88699589
eggNOG 1 0.900 E1_KOG2246
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23033
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.