DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2975 and C1GalTA

Sequence 1:NP_608719.1 Gene:CG2975 FlyBaseID:FBgn0031468 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_609258.1 Gene:C1GalTA FlyBaseID:FBgn0032078 Length:388 Species:Drosophila melanogaster

Alignment Length:380 Identity:160/381 (42%)
Similarity:218/381 (57%) Gaps:39/381 (10%)


  Fly     4 RPNRKRLELMLMLLIGLAWGILLSELM-----KRTRWQ-------------NHADRLKEESSPFP 50
            |.|::.   .:.|::||..|..|:||.     :|:.:.             :|:..:.|.|.|..
  Fly    16 RSNKRS---FVSLIVGLIVGFCLAELFVYSTPERSEFMPYDGHRHGDVNDAHHSHDMMEMSGPEQ 77

  Fly    51 SSQRSRNLRTPPTIAPSTTNPPPDILAARLFNETRVLCMVLTSPKTHHTRAIHIKRTWGRRCNKL 115
            ......::....||            |.||::|.||||.::|:|..|..:|.|:|||||:|||||
  Fly    78 DVGGHEHVHENSTI------------AERLYSEVRVLCWIMTNPSNHQKKARHVKRTWGKRCNKL 130

  Fly   116 IFMSTKADKELGSVALNVREGYSNLWPKTRAALQYVYKHHFQKYDWFLKADDDTYFIMENLRAFL 180
            ||||:..|.||.:|||.|.||.:|||.||:.|.:|:|:||....|||||||||||.|:||:|..|
  Fly   131 IFMSSAKDDELDAVALPVGEGRNNLWGKTKEAYKYIYEHHINDADWFLKADDDTYTIVENMRYML 195

  Fly   181 HAHNFREPVYFGNKFRQHVKEGYMSGGAGYVLSKMALHRLIKLGFSNSSICTNRNYGYEDVELGR 245
            :.::...|||||.||:.:||:||||||||||||:.|:.|.:.....|..:|.:.|.|.||||:|:
  Fly   196 YPYSPETPVYFGCKFKPYVKQGYMSGGAGYVLSREAVRRFVVEALPNPKLCKSDNSGAEDVEIGK 260

  Fly   246 CLAGVGVVGGDSRDEQGLSRFIPFSP-LHWYPQPPD---WYQPLLYYTSPDNSSDCCSNTAISFH 306
            ||..|.|:.|||||..|..||.||.| .|..|...|   ||...::|.: |...||||:.|||||
  Fly   261 CLQNVNVLAGDSRDSNGRGRFFPFVPEHHLIPSHTDKKFWYWQYIFYKT-DEGLDCCSDNAISFH 324

  Fly   307 YNNAQEFYVLEYIIYKLRIFGINRELGPLPKKKASSRPM-SINLQTTKEENGHIA 360
            |.:..:.|||:|:||.||.:||......||.|.|....| .|..|.|:..:..::
  Fly   325 YVSPNQMYVLDYLIYHLRPYGIINTPDALPNKLAVGELMPEIKEQATESTSDGVS 379

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2975NP_608719.1 Galactosyl_T 90..>214 CDD:304462 75/124 (60%)
C1GalTANP_609258.1 Galactosyl_T 119..>265 CDD:304462 83/146 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C88690394
eggNOG 1 0.900 E1_KOG2246
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_130429
Panther 1 1.100 P PTHR23033
RoundUp 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.