DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2975 and CG18558

Sequence 1:NP_608719.1 Gene:CG2975 FlyBaseID:FBgn0031468 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_608720.2 Gene:CG18558 FlyBaseID:FBgn0031469 Length:588 Species:Drosophila melanogaster

Alignment Length:309 Identity:118/310 (38%)
Similarity:171/310 (55%) Gaps:29/310 (9%)


  Fly    47 SPFPSSQRSRNLRTPPTIAPSTTNPPPDILAARLFNETRVLCMVLTSPKTHHTRAIHIKRTWGRR 111
            :|.|      .||:|..:....:.|..|.||..::...|::|:|||.||.:.:.|..|..||||.
  Fly   289 TPLP------ELRSPNPLTKIASRPLNDQLAKMMYRSVRIICLVLTWPKKYMSGARAISETWGRH 347

  Fly   112 CNKLIFM-----STKADKELGSVALNVREGYSNLWPKTRAALQYVYKHHFQKYDWFLKADDDTYF 171
            ||::|:.     :|.:..|:  |.||..:..|.||.||:||.::.|:::..:.|||.|||||||.
  Fly   348 CNRVIYYGSFPGTTISGLEI--VGLNASDTRSKLWGKTKAAFRHAYRNYGHEVDWFYKADDDTYA 410

  Fly   172 IMENLRAFLHAHNFREPVYFGNKFRQHVKEG---YMSGGAGYVLSKMALHRLIKLGFSNSSICTN 233
            :|||:|..|..::...|:|||:.|    |.|   ||||||||||||.|: .|:.||.:.:  |..
  Fly   411 VMENMRKLLKPYSPSNPIYFGSPF----KLGSTLYMSGGAGYVLSKSAV-ELLNLGAAEN--CQP 468

  Fly   234 RNYGYEDVELGRCLAGVGVVGGDSRDEQGLSRFIPFSPLHW-YPQPPD---WYQPLLYYTSPDNS 294
            .:.|.||..:|:||:.:.|..|||||..|..||...|..|: .|...|   |.|..||.|: ...
  Fly   469 GDQGTEDYVMGKCLSLLQVQAGDSRDLLGRQRFFSLSLEHFLIPNRDDEGFWLQEYLYQTT-GTG 532

  Fly   295 SDCCSNTAISFHYNNAQEFYVLEYIIYKLRIFGINRELGPLPKKKASSR 343
            .:|||..:||.|..:..|.:.||.|:||.|.:|:.....| |::.:.:|
  Fly   533 LECCSTYSISIHNVSPYEMHFLETILYKRRPYGLLAGHAP-PRRLSKNR 580

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2975NP_608719.1 Galactosyl_T 90..>214 CDD:304462 60/132 (45%)
CG18558NP_608720.2 Galactosyl_T <400..>458 CDD:304462 35/63 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C88699569
eggNOG 1 0.900 E1_KOG2246
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23033
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.