DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2975 and CG3119

Sequence 1:NP_608719.1 Gene:CG2975 FlyBaseID:FBgn0031468 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_608717.2 Gene:CG3119 FlyBaseID:FBgn0031466 Length:355 Species:Drosophila melanogaster

Alignment Length:380 Identity:118/381 (31%)
Similarity:192/381 (50%) Gaps:50/381 (13%)


  Fly     7 RKRLELMLMLLIGLAWGILLSELMKRTRWQNHADRLKEESSPFPSSQRSRNLRTPPTIAPSTTNP 71
            :.:|...|.||.|...|.:|:.::....:         :.|.......|.:..|..|.|.....|
  Fly     4 KMKLRSQLHLLTGFMAGFVLAFVLLLYVY---------DVSRVTPCWSSTSTMTTATTARIEDGP 59

  Fly    72 PPDILAARLFNETRVLCMVLTSPKTHHTRAIHIKRTWGRRCNKLIFMSTKADKELGSVAL--NVR 134
            ||           |:||||||.|:...:.|..:..|||:||::|||.|::..:.||.|.:  ...
  Fly    60 PP-----------RILCMVLTCPENVQSLARSVYETWGQRCSRLIFASSEDYEPLGVVGVVEPTG 113

  Fly   135 EGYSNLWPKTRAALQYVYKHHFQKYDWFLKADDDTYFIMENLRAFLHAHNFREPVYFGNKFRQHV 199
            .||.:||.|||...::|::|:...||||||||||||.:||||:..|...:...||:||.|..:: 
  Fly   114 GGYEDLWNKTREGFRHVWEHYAGDYDWFLKADDDTYVVMENLQHLLRGFDPNTPVFFGYKMSRY- 177

  Fly   200 KEGYMSGGAGYVLSKMALHRLIKLGFSNSSICTN-RNYGYEDVELGRCLAGVGV--------VGG 255
            ...||||||.|:||:.||||.....:.:..||.. :..|.||..:|.|:..|||        :.|
  Fly   178 NVSYMSGGASYILSREALHRFATQAYESEVICPQPKKMGIEDFYMGICMQNVGVHFVDSTHALDG 242

  Fly   256 DSRDEQGLSRFIPFSPLHWYPQP----PDWYQPLLYYTSPDNSSDCCSNTAISFHYNNAQEFYVL 316
            |::     .:|:|....::....    |:|.: |:..:..:....||||.:::|||.:.:..::.
  Fly   243 DTK-----PKFMPLDLENYMSDANYTIPEWLR-LMSLSRVETGLACCSNYSVAFHYASRERMFLY 301

  Fly   317 EYIIYKLRIFGINRELGPLPKKKASSRPMSINLQTTK---EENGHIALIKMMPRK 368
            |::||.|::|..|:    :.::...|| ::::..|.:   |:|.:|..:..|..|
  Fly   302 EFLIYHLKVFDPNQ----ISERGHRSR-LTLSDLTRRFPLEDNSNIKDLLQMSEK 351

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2975NP_608719.1 Galactosyl_T 90..>214 CDD:304462 57/126 (45%)
CG3119NP_608717.2 Galactosyl_T 86..235 CDD:304462 64/150 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C158951332
eggNOG 1 0.900 E1_KOG2246
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23033
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.