DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2975 and tgy

Sequence 1:NP_608719.1 Gene:CG2975 FlyBaseID:FBgn0031468 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001285425.1 Gene:tgy FlyBaseID:FBgn0030984 Length:373 Species:Drosophila melanogaster

Alignment Length:365 Identity:134/366 (37%)
Similarity:198/366 (54%) Gaps:47/366 (13%)


  Fly     4 RPNRKRLELMLML----LIGL--AWGILLSELMKRTRWQNHADRLKEESSPFPSSQRSRNLRTPP 62
            |.:..||.|:::|    :|||  .|.:::               |...:.|.     ||...:..
  Fly    34 RISTDRLVLLILLVSTTVIGLFAYWDVMV---------------LNAGALPL-----SRGTSSVD 78

  Fly    63 TIAPSTTNPPPDILAARLFNETRVLCMVLTSPKTHHTRAIHIKRTWGRRCNKLIFMSTKADKELG 127
            .:.|...|   :.||.::..|.||||.|||:||.|.|||||:.||||:||||:.||:::.|.||.
  Fly    79 YMEPGLRN---ETLAEKMHREVRVLCWVLTTPKYHKTRAIHVLRTWGKRCNKIYFMTSEPDDELP 140

  Fly   128 SVALNVREGYSNLWPKTRAALQYVYKHHFQKYDWFLKADDDTYFIMENLRAFLHAHNFREPVYFG 192
            :|.|...:.|..||.||:.|..::::....:.|||:|||||||..:||||..|:.::...|:|||
  Fly   141 TVVLTKPDRYEMLWGKTKEAFVHIHEQMRHEADWFIKADDDTYLFLENLRYMLYPYSPETPIYFG 205

  Fly   193 NKFRQ---HVK-EGYMSGGAGYVLSKMALHRLIKLGFSNSSICTNRNYGYEDVELGRCLAGVGVV 253
            ..::.   |.| |.|||||:|||||:.|| |:...|.::::.|...:...||||:|:||..:||.
  Fly   206 FNYKMVGTHQKNESYMSGGSGYVLSREAL-RIFAEGVNDTTKCRQEDDHAEDVEMGKCLFNLGVK 269

  Fly   254 GGDSRDEQGLSRFIPFSP----LHWYPQPPDWYQPLLYYTSPDNSSDCCSNTAISFHYNNAQEFY 314
            .|||||||..:||.|.:|    |........|.....|| :|.:..||.|...::|||.::::.|
  Fly   270 AGDSRDEQLRNRFYPIAPYGALLSGNVGMDFWLYKYAYY-NPRSCMDCLSEYPVAFHYVHSKQLY 333

  Fly   315 VLEYIIYKLRIFGINRELGPLPKK--------KASSRPMS 346
            |.:|..|:.::.|..:....||||        ..|..|:|
  Fly   334 VYDYFNYQFQLSGRAQVAERLPKKIREEELVIPESDNPVS 373

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2975NP_608719.1 Galactosyl_T 90..>214 CDD:304462 64/128 (50%)
tgyNP_001285425.1 Galactosyl_T 103..>270 CDD:304462 78/168 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C88699555
eggNOG 1 0.900 E1_KOG2246
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23033
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.