DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2975 and c1galt1c1

Sequence 1:NP_608719.1 Gene:CG2975 FlyBaseID:FBgn0031468 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_955961.2 Gene:c1galt1c1 ZFINID:ZDB-GENE-030131-2772 Length:317 Species:Danio rerio

Alignment Length:275 Identity:77/276 (28%)
Similarity:126/276 (46%) Gaps:39/276 (14%)


  Fly    83 ETRVLCMVLTSPK--THHTRAIHIKRTWGRRCNKLIFMSTKADKELGSVALNVREGYSNLWPKTR 145
            :.||.|:::.:||  .|...|   ..||.:.|:|.:|.:::|.|.|.:|.|..::.    |.:.|
Zfish    66 QVRVYCLIMVTPKLLVHWATA---NDTWSKHCDKSVFYTSEASKALDAVDLQEQDE----WTRLR 123

  Fly   146 AALQYVYKHHFQKYDWFLKADDDTYFIMENLRAFLHAHNFREPVYFGNKFRQHVKEG---YMSGG 207
            .|:|:.|::....: ||..|...|:.|:|||:..:...:..:|.|.|:.    .|.|   |:...
Zfish   124 KAIQHAYENAGDLH-WFFIARPTTFAIIENLKYLVLDKDPSQPFYIGHT----EKSGELDYVEYD 183

  Fly   208 AGYVLSKMALHRLIKLGFSNSSICTNRNYGY----EDVELGRCLAGVGVVGGDSRDEQGLSRFIP 268
            :|.|||..|:.||::: |.:...|..|....    |:.:|..||...||...:..|.||...|..
Zfish   184 SGIVLSYEAMRRLMEV-FKDEDKCPERGRALWKMSEEKQLATCLKYSGVFAENGEDAQGKGLFNK 247

  Fly   269 FSPLHWYPQPPDWYQPLLYYTSPDNSSD----CCSNTAISFHYNNAQEFYVLEYIIYKLRIFG-- 327
            .|           ...|:..:...|..|    |||:.||:|...:..:..||.|.:|:||.:|  
Zfish   248 KS-----------VSSLISDSISQNPGDVVEACCSDMAITFAGMSPSQIQVLMYGVYRLRPYGHD 301

  Fly   328 INRELGPLPKKKASS 342
            .:..|..||.|.:.:
Zfish   302 FHDSLTFLPPKDSDN 316

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2975NP_608719.1 Galactosyl_T 90..>214 CDD:304462 37/129 (29%)
c1galt1c1NP_955961.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23033
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.