DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2975 and B3gnt9

DIOPT Version :9

Sequence 1:NP_608719.1 Gene:CG2975 / 33481 FlyBaseID:FBgn0031468 Length:385 Species:Drosophila melanogaster
Sequence 2:XP_008770778.1 Gene:B3gnt9 / 291958 RGDID:1310170 Length:398 Species:Rattus norvegicus


Alignment Length:330 Identity:71/330 - (21%)
Similarity:102/330 - (30%) Gaps:103/330 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RKRL--ELMLMLLIGLAWGILLSELMKRTRWQNHADRLKEESSPFPSSQRSRNLRTPPTI----- 64
            |.||  :..|.||:..|.|:||............|...:....|.|:..| |.|..|.|.     
  Rat     4 RPRLCRDAWLTLLLSAALGLLLYAQRDGVSPTTRAPPARGRQLPRPTPGR-RALELPNTAHAAPP 67

  Fly    65 -------APSTTNPPPDILAARLFNETRVLCMVLTSPKTHHT----------------------R 100
                   .|.|...|.|........:.|...:::..|:..|:                      |
  Rat    68 AYEGETPVPPTPTDPFDFRRYLRAKDQRRFPLLINQPRKCHSDGASGGSLDLLIAVKSVAADFER 132

  Fly   101 AIHIKRTWG----------RRCNKLIFMSTKADKELGSVALNVR-----------EGYSN--LWP 142
            ...:::|||          ||    :|: ....|..||.....|           ..|::  ||.
  Rat   133 REAVRQTWGAEGRVQGALVRR----VFL-LGVPKGAGSGGAGTRTHWRALLEAESRAYADILLWA 192

  Fly   143 KTRAALQYVYKH-HFQKY--------DWFLKADDDTYFIMENLRAFLHAHNFREPVYFGNKFRQ- 197
            ..........|. ||..:        .:..|.|.|.:..:.||..||...:..:.:..|:...| 
  Rat   193 FEDTFFNLTLKEIHFLSWASAFCPDVHFVFKGDADVFVHVRNLLQFLEPRDPAQDLLAGDVIVQA 257

  Fly   198 -------------------HVKEGYMSGGAGYVLSKMALHRLIKLGFSNSSICTN-RNYGYEDVE 242
                               .|...| :||.|:|||...||||       :..||. ..:..:||.
  Rat   258 RPIRARASKYFIPQAVYGLPVYPAY-AGGGGFVLSGATLHRL-------AHACTQVELFPIDDVF 314

  Fly   243 LGRCL 247
            ||.||
  Rat   315 LGMCL 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2975NP_608719.1 Galactosyl_T 90..>214 CDD:304462 35/197 (18%)
B3gnt9XP_008770778.1 Galactosyl_T 131..330 CDD:304462 46/202 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.