DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2975 and C1GALT1C1

Sequence 1:NP_608719.1 Gene:CG2975 FlyBaseID:FBgn0031468 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001011551.1 Gene:C1GALT1C1 HGNCID:24338 Length:318 Species:Homo sapiens

Alignment Length:271 Identity:75/272 (28%)
Similarity:120/272 (44%) Gaps:46/272 (17%)


  Fly    85 RVLCMVLTSPKTHHTRAIHIKRTWGRRCNKLIFMSTKADKELGSVALNVREGYSNLWPKTRAALQ 149
            ||.|::|..||.....|. :|.||.:.|:|..|.|::..|...|:.::.    :::|...|.|.:
Human    68 RVYCIILVKPKDVSLWAA-VKETWTKHCDKAEFFSSENVKVFESINMDT----NDMWLMMRKAYK 127

  Fly   150 YVYKHHFQKYDWFLKADDDTYFIMENLRAFLHAHNFREPVYFGNKFRQHVKEG---YMSGGAGYV 211
            |.:..:..:|:||..|...|:.|:|||:.||...:..:|.|.|:.    :|.|   |:....|.|
Human   128 YAFDKYRDQYNWFFLARPTTFAIIENLKYFLLKKDPSQPFYLGHT----IKSGDLEYVGMEGGIV 188

  Fly   212 LSKMALHRLIKLGFSNSSI-----CTNRNYGY-----EDVELGRCLAGVGVVGGDSRDEQGLSRF 266
            ||..::.||      ||.:     |..:. |.     ||.:|..||...||...::.|..|...|
Human   189 LSVESMKRL------NSLLNIPEKCPEQG-GMIWKISEDKQLAVCLKYAGVFAENAEDADGKDVF 246

  Fly   267 ----IPFSPLHWYPQPPDWYQPLLYYTSPDNSSDCCSNTAISFHYNNAQEFYVLEYIIYKLRIFG 327
                :..|           .:..:.|........|||:.|::|:.....:.:|:.|.:|:||.||
Human   247 NTKSVGLS-----------IKEAMTYHPNQVVEGCCSDMAVTFNGLTPNQMHVMMYGVYRLRAFG 300

  Fly   328 --INRELGPLP 336
              .|..|..||
Human   301 HIFNDALVFLP 311

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2975NP_608719.1 Galactosyl_T 90..>214 CDD:304462 38/127 (30%)
C1GALT1C1NP_001011551.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23033
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.