DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2975 and B3gnt7

DIOPT Version :9

Sequence 1:NP_608719.1 Gene:CG2975 / 33481 FlyBaseID:FBgn0031468 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_660257.2 Gene:B3gnt7 / 227327 MGIID:2384394 Length:397 Species:Mus musculus


Alignment Length:330 Identity:69/330 - (20%)
Similarity:116/330 - (35%) Gaps:98/330 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 WQNHADRLKEESSPFPSSQRSRN----LRTPPTIAPSTTNPP------PDILAARLFNETRVLCM 89
            |::.    |:.::|.|:..|...    :.|..:|..:.|:.|      |.......:...|...|
Mouse    58 WKSS----KDVAAPTPTVPRGPQVWDVITTNCSININLTHQPWFQSLEPHFRQFLAYRHCRYFPM 118

  Fly    90 VLTSPK----------------THHTRAIHIKRTW---------GRRCNKLIFMSTKADKELGSV 129
            :|..|:                |.|.|...|::||         ||...:.:|:...|.|:    
Mouse   119 LLNHPEKCAGDVYMLVVVKSVITQHDRREVIRQTWGHEWESAGLGRGAVRTLFLLGTASKQ---- 179

  Fly   130 ALNVREGYSNL-------------WPKTRAALQYVYKH-HFQKY--------DWFLKADDDTYFI 172
              ..|..|..|             |....:......|. ||.|:        .:..|.|||.:..
Mouse   180 --EERTHYQQLLAYEDRLYADILQWDFLDSFFNLTLKEIHFLKWLDIYCPNVPFVFKGDDDVFVN 242

  Fly   173 MENLRAFLHAHNFREPVYFG-------------NKFR----QHVKEGY--MSGGAGYVLSKMALH 218
            ..||..||.....:|.::.|             ||:.    .:.|..|  .:||.|:::|.....
Mouse   243 PTNLLEFLSDRQPQENLFVGDVLKHARPIRKKDNKYYIPAVMYGKATYPPYAGGGGFLMSGSLAR 307

  Fly   219 RLIKLGFSNSSICTNRNYGYEDVELGRCLAGVGV--VGGDSRDEQGLSRFIPFSPLHWYPQPPDW 281
            :|      :.:..|...:..:||.||.||..:||  .|.:.....|:|| :..|.::   :.|.:
Mouse   308 QL------HHACDTLELFPIDDVFLGMCLEVLGVKPTGHEGFKTFGISR-VRSSRMN---KEPCF 362

  Fly   282 YQPLL 286
            |:.:|
Mouse   363 YRAML 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2975NP_608719.1 Galactosyl_T 90..>214 CDD:304462 38/189 (20%)
B3gnt7NP_660257.2 Galactosyl_T 144..338 CDD:304462 45/205 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.