DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2975 and F56H6.1

Sequence 1:NP_608719.1 Gene:CG2975 FlyBaseID:FBgn0031468 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_493101.1 Gene:F56H6.1 WormBaseID:WBGene00010162 Length:327 Species:Caenorhabditis elegans

Alignment Length:253 Identity:84/254 (33%)
Similarity:129/254 (51%) Gaps:16/254 (6%)


  Fly    61 PPT--IAPSTTNPPPDILAARLFNETRVLCMVLTSPKTHHTRAIHIKRTWGRRC-NKLIFMST-- 120
            |||  |...|........|..|.:..::.|.|.||...:..|...|..||..:| |...|..|  
 Worm    53 PPTRSIGKLTPGIVHSASALELPSTGQLFCFVETSAVHYDDRVPSIASTWLPKCDNGRFFTKTPL 117

  Fly   121 -KADKELGSVALNVREGYSNLWPKTRAALQYVYKHHFQKYDWFLKADDDTYFIMENLRAFLHAHN 184
             .::....:|.||:::.|.:|:.||.....|.|.|..:.:||:|||||||||.|::|:.:|...:
 Worm   118 PNSNMTYSTVYLNLKDSYYDLFRKTTFGFYYSYMHISKSFDWYLKADDDTYFAMDHLKEYLSTLD 182

  Fly   185 FREPVYFGNKFRQHVKEGYMSGGAGYVLSKMALHRLIKLGFSNSSICTNRNYGY-EDVELGRCLA 248
            ..:|:|.|...:.:.|.||.|||:||:||..|:...::..:.:...|.   |.: ||..:|||:|
 Worm   183 PTKPLYLGYVLKPYFKNGYNSGGSGYILSNAAVKLFVEKLYHDEYTCP---YDWAEDRGMGRCMA 244

  Fly   249 GVGVVGGDSRDEQGLSRFIPFSPLHWYPQPPDWYQPLLYYTSPDNSSDCCSNTAISFH 306
            ..|:...|:||::||:||:||.|.......|:|:    ||  |..:....|...:|.|
 Worm   245 RAGIFPTDTRDDKGLNRFMPFKPSELAGVGPEWH----YY--PMEAGQYASQKFVSLH 296

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2975NP_608719.1 Galactosyl_T 90..>214 CDD:304462 48/128 (38%)
F56H6.1NP_493101.1 Galactosyl_T <127..254 CDD:304462 48/130 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C88701556
eggNOG 1 0.900 E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D555141at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23033
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.900

Return to query results.
Submit another query.