DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2975 and F37A4.3

Sequence 1:NP_608719.1 Gene:CG2975 FlyBaseID:FBgn0031468 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_498472.2 Gene:F37A4.3 WormBaseID:WBGene00018133 Length:272 Species:Caenorhabditis elegans

Alignment Length:384 Identity:72/385 (19%)
Similarity:116/385 (30%) Gaps:149/385 (39%)


  Fly    23 GILLSELMKRTRWQNHADRLKEESSPFPSSQRSRNLRTPPTIAPSTTNPPPDILAARLFNETRVL 87
            |:||..:.|..|....|...:.|:..|.....:....|..:..|..||                |
 Worm    11 GLLLFRVGKLMRNDKLAWSAEYEAKKFKFYHNTSLFLTLQSTGPEMTN----------------L 59

  Fly    88 CMVLTSPKTHHTRAIHIKRTWGRRCNKL--IFMSTKADKELGSVALNVREGYSNLWPKTRAALQY 150
            |                |::|   |:|:  .|:              |...|.| |.|...  |:
 Worm    60 C----------------KKSW---CDKVDDYFV--------------VPHHYVN-WQKPTE--QW 88

  Fly   151 VYKHHF-----------QKYDWFLKADDDTYFIMENLRAFLHAHNFREPVY-FGNKFRQHVKEGY 203
            :. |||           |:..|::.|.|:.||.:|.|...|...:...|:| ....|...::   
 Worm    89 LI-HHFSKMILHTRRLPQQAQWYMFAFDNNYFFVERLIKELSKFDSHLPIYTILRDFHADIQ--- 149

  Fly   204 MSGGAGYVLSKMALHRLIKLGFSNSSICTNRNYGYEDVELGRCLAGVGVVGGDSRDEQGLSRFIP 268
                          |:.: |.||.|::.|     :.|:|...|          |.:.:.:..:: 
 Worm   150 --------------HKPV-LIFSRSALNT-----FYDLEEENC----------SENAENVEEWL- 183

  Fly   269 FSPLHWYPQPPDWYQPLLYYTSPDNSSDCCSNTAISFHYNNAQEFYVLEYIIYKLRIFGINR--- 330
                                      :.|.|...|:...:.::          |.|||.|.|   
 Worm   184 --------------------------TTCMSIPPITISVDRSK----------KSRIFAIKRHFQ 212

  Fly   331 --ELGPLPK-----KKASSRPMSINLQTTKEENGHIALIKMMPRKNVTTPNYRTKTTSK 382
              |:..:|.     |....|..|..|..|......:.|:.:...|  ....|:.|..||
 Worm   213 VDEMKTMPNDYHDDKDYIHRHSSSLLSFTNLSLEDLKLLPIFVEK--VQGGYKKKAASK 269

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2975NP_608719.1 Galactosyl_T 90..>214 CDD:304462 26/138 (19%)
F37A4.3NP_498472.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23033
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.