DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2975 and C02H6.1

Sequence 1:NP_608719.1 Gene:CG2975 FlyBaseID:FBgn0031468 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_504891.1 Gene:C02H6.1 WormBaseID:WBGene00015361 Length:334 Species:Caenorhabditis elegans

Alignment Length:250 Identity:80/250 (32%)
Similarity:134/250 (54%) Gaps:17/250 (7%)


  Fly    85 RVLCMVLTSPKTHHTRAIHIKRTWGRRC-NKLIFMSTK-ADKEL--GSVALNVREGYSNLWPKTR 145
            ::.|.|.||.|..:.|...:..||..|| |...|:.|. .|:::  .:|..|:.:.|.:|:.||.
 Worm    86 QLFCFVETSKKYFNDRVPSMASTWLPRCDNGRFFLKTPLVDEKIPFSTVYRNLEDSYYDLFRKTL 150

  Fly   146 AALQYVYKHHFQKYDWFLKADDDTYFIMENLRAFLHAHNFREPVYFGNKFRQHVKEGYMSGGAGY 210
            .:..|.|.:..:.:||:||||||.||::::|:.:|...:..:|::.|.:.:..::.||.||||||
 Worm   151 LSFYYSYTYISKDFDWYLKADDDNYFMIDHLKEYLDTLDASKPLFLGYRMKPFLEGGYNSGGAGY 215

  Fly   211 VLSKMALHRLIKLGFSNSSICTNRNYGY-EDVELGRCLAGVGVVGGDSRDEQGLSRFIPFSPLHW 274
            :||..|:...::..:.:...|.   |.: ||..:.||||.:|::..|:||..|..||:||.|.. 
 Worm   216 LLSNAAVRIFVEHLYHDEKRCP---YDWAEDRGIARCLASMGILPSDTRDNDGSCRFLPFRPSE- 276

  Fly   275 YPQPPDWYQPLLYYTSPDNSSDCCSNTAISFHYNNAQEFYVLEYIIY---KLRIF 326
            .|..|:.|.   ||  |..:....|...||.|..:.::...|:.|:|   :.|:|
 Worm   277 MPGIPEAYH---YY--PLKNGSFVSEKFISLHRISPRKMIFLDSILYPSSERRLF 326

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2975NP_608719.1 Galactosyl_T 90..>214 CDD:304462 45/128 (35%)
C02H6.1NP_504891.1 Galactosyl_T 83..>223 CDD:304462 47/137 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C88701525
eggNOG 1 0.900 E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23033
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.900

Return to query results.
Submit another query.