DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2975 and ZC250.2

Sequence 1:NP_608719.1 Gene:CG2975 FlyBaseID:FBgn0031468 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_504520.2 Gene:ZC250.2 WormBaseID:WBGene00022576 Length:449 Species:Caenorhabditis elegans

Alignment Length:331 Identity:71/332 (21%)
Similarity:120/332 (36%) Gaps:103/332 (31%)


  Fly    23 GILLS----ELMKRT----RWQNHADRLKEESSPFPSSQRSRNLRTPP-------TI-------- 64
            |.:||    |::::.    ||...|...|.|.:.|.....:..|...|       ||        
 Worm   148 GFILSKSVVEIIRKVDINDRWSGFAIDAKYEFAQFLHKWENLRLHHHPDYFCCGDTIDSCIVKCS 212

  Fly    65 --APSTTNPPPDILAARLFNETRVLCMVLTSPKTHHTRAIHIKRTWGRRCNKLIFMSTKADKELG 127
              .|.|:|.         .:::.|..||.|....|..|...:|.||....:::.:.|.|.|..:.
 Worm   213 IPFPKTSNS---------ISDSEVHVMVKTFEGHHVNRLEVLKNTWASDVSRIEYCSDKEDPAIP 268

  Fly   128 SVALNV----REGYSNLWPKTRAALQYVYKHHFQKY--------DWFLKADDDTYFIMENLRAFL 180
            ::.|.|    |...:..|            ..|:::        .|.:.|||||....:.|:..|
 Worm   269 TINLGVDNTDRGHCAKTW------------EIFRRFLGSSGNGAKWLVVADDDTLMNFKRLKQML 321

  Fly   181 HAHNFREPVYFGNK----FRQHVKEG--YMSGGAGYVLSKMALHRLIKLGFSNSSICTN--RNYG 237
            ..::..:.:..|.:    |..:...|  |.:||:|.:.::.|:..|:       :.|.:  .|..
 Worm   322 ELYDSGDKIIIGERYGYGFSLNGDSGYDYPTGGSGMIFTRSAVESLL-------AQCPSCIANTD 379

  Fly   238 YEDVELGRC--LAGVGVVGGDSRDEQGLSRFIPFSPLHWYPQPPDWYQPLLYYTSPDNSSDCCSN 300
            .:|:.:|.|  .||:.:| .:||..|.       .||.:.|:         |...|         
 Worm   380 PDDMTIGICALTAGIPIV-HESRLHQA-------RPLDYAPE---------YIKYP--------- 418

  Fly   301 TAISFH 306
              ||||
 Worm   419 --ISFH 422

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2975NP_608719.1 Galactosyl_T 90..>214 CDD:304462 30/142 (21%)
ZC250.2NP_504520.2 Galactosyl_T 231..424 CDD:304462 52/240 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.