DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2975 and Y38C1AB.1

Sequence 1:NP_608719.1 Gene:CG2975 FlyBaseID:FBgn0031468 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_499857.3 Gene:Y38C1AB.1 WormBaseID:WBGene00021403 Length:261 Species:Caenorhabditis elegans

Alignment Length:239 Identity:70/240 (29%)
Similarity:117/240 (49%) Gaps:3/240 (1%)


  Fly    86 VLCMVLTSPKTHHTRAIHIKRTWGRRCNK-LIFMSTKADKELGSVALNVREGYSNLWPKTRAALQ 149
            :||::.|:..:|.|||..|..||.:.|:. |.|..:|.:..:..:...:.....:.|.|.|...:
 Worm    22 ILCLIHTATPSHETRAKTILETWVQHCDDFLFFTDSKMNDSIPHIYYPLLNSRDHSWEKIRRVFK 86

  Fly   150 YVYKHHFQKYDWFLKADDDTYFIMENLRAFLHAHNFREPVYFGNKFRQHVKEGYMSGGAGYVLSK 214
            ||.....:||||:.:||||||.:|.|:|..|..::..:..|.|.::......|: :.|:.|:||:
 Worm    87 YVRDKITKKYDWYYRADDDTYALMHNMRTLLDNYSPTKHHYLGLQWNFFTPRGF-NDGSSYILSR 150

  Fly   215 MALHRLIKLGFSNSSICTNRNYGYEDVELGRCLAGVGVVGGDSRDEQGLSRFIPFSPLHWYPQPP 279
            ..:....:: ..:...|.:.:...||.||.:|||.:.:...|.|||.|..|...|.||.......
 Worm   151 PTMEAFNEV-MLDPDRCPDHHRAEEDQELAKCLAHMEIYPEDIRDEMGSERIQHFHPLEQLTIYK 214

  Fly   280 DWYQPLLYYTSPDNSSDCCSNTAISFHYNNAQEFYVLEYIIYKL 323
            |.:...|.|.......:..|:..||||:.:..|..:::||.|:|
 Worm   215 DTFNRRLAYYPAMKEDENFSDKMISFHHVSPYEMRLMDYIFYRL 258

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2975NP_608719.1 Galactosyl_T 90..>214 CDD:304462 38/125 (30%)
Y38C1AB.1NP_499857.3 Galactosyl_T 33..>129 CDD:304462 31/96 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C88678744
eggNOG 1 0.900 E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23033
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.900

Return to query results.
Submit another query.