DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2975 and W09D10.5

Sequence 1:NP_608719.1 Gene:CG2975 FlyBaseID:FBgn0031468 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_499361.3 Gene:W09D10.5 WormBaseID:WBGene00012363 Length:321 Species:Caenorhabditis elegans

Alignment Length:363 Identity:82/364 (23%)
Similarity:130/364 (36%) Gaps:109/364 (30%)


  Fly     7 RKRLELMLMLLIGLAWGILL---------SELMKRTRWQNHADRLKEESSPFPSSQRSRNLRTPP 62
            |...::::.|.:|::.|.|:         :::.|......|     |:|:|.|   .|.|||   
 Worm    12 RSPRDVVIHLALGVSLGYLIGILFIFDGDNDISKHIHLMEH-----EKSTPKP---ESFNLR--- 65

  Fly    63 TIAPSTTNPPPDILAARLFNETRVLCMVLTSPKTHHTRAI--HIKRTWGRRCNKLIFMSTKADKE 125
                                     |:::....||....|  .|...:.:.|.:.||.:.  :::
 Worm    66 -------------------------CVIILHKATHKPENIISAITDGYAKLCQETIFFTN--NQK 103

  Fly   126 LGSVALNVREGY------SNL----WPKTRAALQYVYKHHFQK---YDWFLKADDDTYFIMENLR 177
            |.......:..|      |:|    |      ..|:|...|..   ..|....||.||.|:.|||
 Worm   104 LFDKFQKFQNNYTMYHVDSSLNHFYW------TYYLYAMEFSSKVPAQWTFLGDDQTYLIVPNLR 162

  Fly   178 AFLHAHNFREPVYFG---------------NKFRQHVKEGYMSGGAGYVLSKMALHRLIK---LG 224
            ..|...:..:||..|               :.|::      :|...|.|||..|:.:|..   ..
 Worm   163 NTLRNFDSEKPVVLGKVKDTSTLFSWLFPLSSFKK------ISVRGGVVLSNPAIDKLSACKGFF 221

  Fly   225 FSNSSICTNRNYGYEDVELGRCLAGVGVVGGDSRDEQGLSRFIPFSPLHWYPQPPDWYQPLLYYT 289
            ||.:|          |..|..|....||...|..||..|..|....|....  .||   ..|:.:
 Worm   222 FSRAS----------DFALYDCSEKYGVQIADPFDEDALRLFNDLPPKQII--APD---SKLFRS 271

  Fly   290 SPDNSSDCCSNTAISFHYNNAQEFYVLEYIIYKLRIFG 327
            ||..:.. ||:.||||...:.::..||::.: .|::||
 Worm   272 SPTKAGK-CSDHAISFGQLSEKDMRVLQFGM-SLKVFG 307

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2975NP_608719.1 Galactosyl_T 90..>214 CDD:304462 34/154 (22%)
W09D10.5NP_499361.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23033
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.