DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2975 and C38H2.2

Sequence 1:NP_608719.1 Gene:CG2975 FlyBaseID:FBgn0031468 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_499293.2 Gene:C38H2.2 WormBaseID:WBGene00008019 Length:389 Species:Caenorhabditis elegans

Alignment Length:269 Identity:129/270 (48%)
Similarity:172/270 (64%) Gaps:6/270 (2%)


  Fly    75 ILAARLFNETRVLCMVLTSPKTHHTRAIHIKRTWGRRCNKLIFMSTKADKELGSVALNVREGYSN 139
            ::|..:..:.||.|.:||..:.|..||.|:|.||.:||||.:|||::.|.||.::.|||.||...
 Worm    95 LIADEVAKKVRVFCWILTGKQNHDKRAKHVKATWAKRCNKYVFMSSEEDAELPAINLNVSEGRDY 159

  Fly   140 LWPKTRAALQYVYKHHFQKYDWFLKADDDTYFIMENLRAFLHAHNFREPVYFGNKFRQHVKEGYM 204
            ||.||:.|.:|:|.||...||||||||||||.:|||||..|.||:..||::||.||:...:.||.
 Worm   160 LWAKTKGAFKYIYDHHLNDYDWFLKADDDTYVVMENLRFMLLAHSPDEPIHFGCKFKPFTQGGYH 224

  Fly   205 SGGAGYVLSKMALHRLIKLGFSNSSICTNRNYGYEDVELGRCLAGVGVVGGDSRDEQGLSRFIPF 269
            |||||||||:.||.:.|::...:.|:|:..:.|.||.|:|:||..|||..|||||..|..||:||
 Worm   225 SGGAGYVLSREALKKFIEVALPDKSLCSQNHGGAEDAEMGKCLEKVGVKAGDSRDADGHHRFMPF 289

  Fly   270 SPLH----WYPQPPDWYQPLLYYTSPDNSSDCCSNTAISFHYNNAQEFYVLEYIIYKLRIFGINR 330
            .|.|    .:..|..|:....||.. |....|||:.|:||||.|....|||||:||.|:.|||:|
 Worm   290 VPEHHLSPGHVDPKFWFWQYTYYPM-DQGPTCCSDYAVSFHYVNPNLMYVLEYLIYHLKPFGIDR 353

  Fly   331 ELGPLPKKK 339
            .: .:||.:
 Worm   354 AI-RVPKNE 361

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2975NP_608719.1 Galactosyl_T 90..>214 CDD:304462 70/124 (56%)
C38H2.2NP_499293.2 Galactosyl_T 106..>274 CDD:304462 87/168 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_130429
Panther 1 1.100 O PTHR23033
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.870

Return to query results.
Submit another query.