DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2975 and B3GLCT

Sequence 1:NP_608719.1 Gene:CG2975 FlyBaseID:FBgn0031468 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_919299.3 Gene:B3GLCT HGNCID:20207 Length:498 Species:Homo sapiens

Alignment Length:313 Identity:77/314 (25%)
Similarity:120/314 (38%) Gaps:67/314 (21%)


  Fly    22 WGILLSELMKRTRWQNHADRLKEES--SPFPSSQR--------SRNLRTPPTIAPSTTNPPPDIL 76
            |.:.:..:.|.|:      |||.||  |.|....:        .:....|.|..|.......|..
Human   190 WALSIPLVNKLTK------RLKSESLKSDFTIDLKHEIALYIWDKGGGPPLTPVPEFCTNDVDFY 248

  Fly    77 AARLFNETRVLC-----------MVLTSPKTHHTRAIHIKRTWGRRCNKLIFMSTKADKELGSVA 130
            .|..|:....||           .|.|..|.|..|...:|:||..:.:.:.:.|...:..:.:|.
Human   249 CATTFHSFLPLCRKPVKKKDIFVAVKTCKKFHGDRIPIVKQTWESQASLIEYYSDYTENSIPTVD 313

  Fly   131 L---NVREGYSNLWPKTRAALQYVYKHHFQKYDWFLKADDDTYFIMENLRAFLHAHNFREPVYFG 192
            |   |...|:..   ||.|.|:........|..|.:..||||...:..|:..|..::..|||:.|
Human   314 LGIPNTDRGHCG---KTFAILERFLNRSQDKTAWLVIVDDDTLISISRLQHLLSCYDSGEPVFLG 375

  Fly   193 NKFRQHVKEG---YMSGGAGYVLSKMALHRLIKLGFSNSSIC-TNRNYGYEDVELGRCLAGVGVV 253
            .::...:..|   |::||.|.|.|:.|:.||:      :|.| ...|...:|:.||.|.:|:|:.
Human   376 ERYGYGLGTGGYSYITGGGGMVFSREAVRRLL------ASKCRCYSNDAPDDMVLGMCFSGLGIP 434

  Fly   254 GGDSRDEQGLSRFIPFSPLHWYPQPPDWYQPLLYYTSPDNSSDCCSNTAISFH 306
                         :..|||....:|.|:.:..|.:..|           ||||
Human   435 -------------VTHSPLFHQARPVDYPKDYLSHQVP-----------ISFH 463

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2975NP_608719.1 Galactosyl_T 90..>214 CDD:304462 36/130 (28%)
B3GLCTNP_919299.3 Galactosyl_T 264..467 CDD:304462 59/234 (25%)
Prevents secretion from ER 495..498
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.