DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2975 and AgaP_AGAP009562

DIOPT Version :9

Sequence 1:NP_608719.1 Gene:CG2975 / 33481 FlyBaseID:FBgn0031468 Length:385 Species:Drosophila melanogaster
Sequence 2:XP_310125.4 Gene:AgaP_AGAP009562 / 1271355 VectorBaseID:AGAP009562 Length:470 Species:Anopheles gambiae


Alignment Length:263 Identity:64/263 - (24%)
Similarity:102/263 - (38%) Gaps:58/263 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 TNPPPDILAARLFNETRVLCMVLTSPKTHHTRAIHIKRTWGRRCNKLIFMSTKADKELGSVALNV 133
            |:.|.::        .:::..|.|..|.|..|...:|:||.|....|.:.|...|..:.::|.:|
Mosquito   233 TDDPTEV--------DQIMFAVKTCSKYHKDRVPALKQTWTRYVQHLRYFSDVDDPTIPTIATSV 289

  Fly   134 REGYSNLWPKTRAALQYV-----YKHHFQKYDWFLKADDDTYFIMENLRAFLHAHNFREPVYFGN 193
            ....:....||...||.:     |....|...|.:..||||......|..||..::....:|.|.
Mosquito   290 PNSSAGHCAKTLEILQLIGDELRYNGSLQAIRWVMLVDDDTILSTSALARFLSCYDPGRDLYLGE 354

  Fly   194 KFRQHV--KEG----YMSGGAGYVLSKM---ALHRLIKLGFSNSSICTNRNYGYEDVELGRCLAG 249
            ::...:  .:|    |::||.|.|||..   ||.|..:...::|.         :|:.|..||..
Mosquito   355 RYGYRLLGADGGGYNYVTGGGGIVLSVAILDALQRTCECPSASSP---------DDMILAACLQR 410

  Fly   250 VGVVGGDSRDEQGLSRFIPFSPLHWYPQPPDWYQPLLYYTSPDNSSDCCSNTAISFHYN---NAQ 311
            :|:            |.| .|||....:|.|:...||     |...      .:|||.:   :.|
Mosquito   411 LGI------------RPI-HSPLFHQARPSDYAPELL-----DRRG------TVSFHKHWQIDPQ 451

  Fly   312 EFY 314
            :.|
Mosquito   452 QVY 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2975NP_608719.1 Galactosyl_T 90..>214 CDD:304462 37/134 (28%)
AgaP_AGAP009562XP_310125.4 Fringe 237..452 CDD:190308 60/255 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.