DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2975 and AgaP_AGAP007720

DIOPT Version :9

Sequence 1:NP_608719.1 Gene:CG2975 / 33481 FlyBaseID:FBgn0031468 Length:385 Species:Drosophila melanogaster
Sequence 2:XP_564504.3 Gene:AgaP_AGAP007720 / 1269523 VectorBaseID:AGAP007720 Length:621 Species:Anopheles gambiae


Alignment Length:197 Identity:42/197 - (21%)
Similarity:74/197 - (37%) Gaps:32/197 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 VKEGYMSGGAGYVLSKMALHRLIKLGFSNSSICTNRNYGYEDVELGRCLAGVGVVGGDSRDEQGL 263
            :|.|..:.|.|.|...: :...:.|...:|:|..|.....:  .|..|.|.:....|.:....||
Mosquito    83 LKNGLTNAGMGMVQPNV-VEAAVSLSNDSSAIVANAPQTSQ--MLHDCTAFIRRQVGSAEILHGL 144

  Fly   264 S-----RFIPFSPLHW-----YP----------QPPDWYQPLLYYTSPDNSSDCCSNTAISFHYN 308
            .     ..|||:  |:     ||          :.|..|:.....::.:.:.:..:..|.|    
Mosquito   145 PLNNEYELIPFN--HFTFSRVYPIELGLGKRVVEKPIGYKRKDILSALNKALETLNRNASS---- 203

  Fly   309 NAQEFYVLEYI--IYKLR-IFGINRELGPLPKKKASSRPMSINLQTTKEENGHIALIKMMPRKNV 370
            :||.:.:.::|  ||:.. ..|...||....|:.|:.......:....|.:|...||.|.|..::
Mosquito   204 SAQRYTLDDFIEGIYRNEPTTGTQYELYFRTKESANRSQQQQQIAQHHESHGTTKLIVMRPFASL 268

  Fly   371 TT 372
            .|
Mosquito   269 QT 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2975NP_608719.1 Galactosyl_T 90..>214 CDD:304462 5/14 (36%)
AgaP_AGAP007720XP_564504.3 Glyco_tranf_GTA_type <119..549 CDD:299700 33/160 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.