DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2975 and LOC100496837

Sequence 1:NP_608719.1 Gene:CG2975 FlyBaseID:FBgn0031468 Length:385 Species:Drosophila melanogaster
Sequence 2:XP_002933733.2 Gene:LOC100496837 XenbaseID:XB-GENE-5871034 Length:279 Species:Xenopus tropicalis

Alignment Length:262 Identity:108/263 (41%)
Similarity:151/263 (57%) Gaps:9/263 (3%)


  Fly    91 LTSPKTHHTRAIHIKRTWGRRCNKLIFMSTKADKELGSVALNVREGYSNLWPKTRAALQYVYKHH 155
            :|.|....|:|||:|.||.|.||..:|||:..|||..::.|...||...|:.||..|..|.:|::
 Frog     1 MTGPSNLQTKAIHVKNTWTRHCNVALFMSSVTDKEFPTIGLGTGEGRDKLYWKTIRAFHYAHKYY 65

  Fly   156 FQKYDWFLKADDDTYFIMENLRAFLHAHNFREPVYFGNKFRQHVKEGYMSGGAGYVLSKMALHRL 220
            ..:.|||.|.||||:.|:||:|..|..:...:|:|||.:|:.::|:||||||||||||:.||.|.
 Frog    66 LNETDWFFKGDDDTFVILENMRWMLSNYTADQPIYFGKRFKPYIKQGYMSGGAGYVLSREALIRF 130

  Fly   221 IKLGFSNSSICTNRNYGYEDVELGRCLAGVGVVGGDSRDEQGLSRFIPFSP-----LHWYPQPPD 280
            :: || .:.|||:.. ..|||.:|.|:..:||:.|||||.:....|.||||     :.:......
 Frog   131 VE-GF-RTGICTHTT-STEDVAIGNCMQLMGVIAGDSRDTEKRETFHPFSPEGHITMKFVDSKSF 192

  Fly   281 WYQPLLYYTSPDNSSDCCSNTAISFHYNNAQEFYVLEYIIYKLRIFGINRELGPLPKKKASSRPM 345
            ||.....|...: ...|||:.||||||.:.:..|.|||:.|.||.:|.:....|...|.|...|:
 Frog   193 WYWSYCVYPIVE-GPQCCSDLAISFHYISPEHMYTLEYLTYHLRAYGYHYRYQPSLPKNADKLPV 256

  Fly   346 SI 347
            .|
 Frog   257 YI 258

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2975NP_608719.1 Galactosyl_T 90..>214 CDD:304462 58/123 (47%)
LOC100496837XP_002933733.2 Galactosyl_T 9..>159 CDD:304462 70/153 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.870

Return to query results.
Submit another query.