DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2975 and c1galt1

Sequence 1:NP_608719.1 Gene:CG2975 FlyBaseID:FBgn0031468 Length:385 Species:Drosophila melanogaster
Sequence 2:XP_002938761.1 Gene:c1galt1 XenbaseID:XB-GENE-992000 Length:362 Species:Xenopus tropicalis

Alignment Length:283 Identity:115/284 (40%)
Similarity:173/284 (61%) Gaps:12/284 (4%)


  Fly    76 LAARLFNETRVLCMVLTSPKTHHTRAIHIKRTWGRRCNKLIFMSTKADKELGSVALNVREGYSNL 140
            :|..|:::.::||.|:|.|:....:..|:|.||.:||||:::||::.:||..:|.|:.:||...|
 Frog    83 VADDLYSKVKILCWVMTGPQNLDKKTKHVKATWAQRCNKVLYMSSEENKEFPTVGLDTKEGRDQL 147

  Fly   141 WPKTRAALQYVYKHHFQKYDWFLKADDDTYFIMENLRAFLHAHNFREPVYFGNKFRQHVKEGYMS 205
            :.||..|.|||:.||.::.|||:|||||||.:::|||..|..|:..:|||||.:|:.:||:||||
 Frog   148 YWKTIKAFQYVHDHHLEEADWFMKADDDTYVVLDNLRWLLSKHDPNDPVYFGRRFKPYVKQGYMS 212

  Fly   206 GGAGYVLSKMALHRLIKLGFSNSSICTNRNYGYEDVELGRCLAGVGVVGGDSRDEQGLSRFIPFS 270
            |||||||||.||.|.:. .|.... ||:.: ..||:.||:|:..:.|..|||||..|...|.||.
 Frog   213 GGAGYVLSKEALKRFVN-AFKEEK-CTHSS-SVEDLALGKCMENINVKAGDSRDTSGKETFHPFV 274

  Fly   271 P----LHWYPQPPDWYQPLLYYTSPDNSSDCCSNTAISFHYNNAQEFYVLEYIIYKLRIFGINRE 331
            |    :|.|.....||....||.:.:... |||:.|:||||.::...|.|||:::.||.:|....
 Frog   275 PEHHLIHGYLPKTFWYWNYNYYPAVEGPG-CCSDLAVSFHYVDSTTMYQLEYLVHHLRPYGYKHR 338

  Fly   332 LGPLPKKKASSRPMSINLQTTKE 354
            ..|    .::::.|..:...||:
 Frog   339 YSP----DSTAKTMKDDTDKTKD 357

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2975NP_608719.1 Galactosyl_T 90..>214 CDD:304462 63/124 (51%)
c1galt1XP_002938761.1 Galactosyl_T <168..>254 CDD:304462 46/89 (52%)
EEP 280..>361 CDD:294334 25/84 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.870

Return to query results.
Submit another query.