| Sequence 1: | NP_608719.1 | Gene: | CG2975 / 33481 | FlyBaseID: | FBgn0031468 | Length: | 385 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_002938761.1 | Gene: | c1galt1 / 100487794 | XenbaseID: | XB-GENE-992000 | Length: | 362 | Species: | Xenopus tropicalis | 
| Alignment Length: | 283 | Identity: | 115/283 - (40%) | 
|---|---|---|---|
| Similarity: | 173/283 - (61%) | Gaps: | 12/283 - (4%) | 
- Green bases have known domain annotations that are detailed below.
| 
 
  Fly    76 LAARLFNETRVLCMVLTSPKTHHTRAIHIKRTWGRRCNKLIFMSTKADKELGSVALNVREGYSNL 140 
  Fly   141 WPKTRAALQYVYKHHFQKYDWFLKADDDTYFIMENLRAFLHAHNFREPVYFGNKFRQHVKEGYMS 205 
  Fly   206 GGAGYVLSKMALHRLIKLGFSNSSICTNRNYGYEDVELGRCLAGVGVVGGDSRDEQGLSRFIPFS 270 
  Fly   271 P----LHWYPQPPDWYQPLLYYTSPDNSSDCCSNTAISFHYNNAQEFYVLEYIIYKLRIFGINRE 331 
  Fly   332 LGPLPKKKASSRPMSINLQTTKE 354  | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| CG2975 | NP_608719.1 | Galactosyl_T | 90..>214 | CDD:304462 | 62/123 (50%) | 
| c1galt1 | XP_002938761.1 | Galactosyl_T | <168..>254 | CDD:389837 | 46/88 (52%) | 
| EEP | 280..>361 | CDD:382041 | 25/83 (30%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1407357at2759 | |
| OrthoFinder | 1 | 1.000 | - | - | FOG0000473 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR23033 | 
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 4 | 4.020 | |||||