DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2975 and LOC100486030

Sequence 1:NP_608719.1 Gene:CG2975 FlyBaseID:FBgn0031468 Length:385 Species:Drosophila melanogaster
Sequence 2:XP_002933747.2 Gene:LOC100486030 ID: Length:276 Species:Xenopus tropicalis

Alignment Length:276 Identity:113/277 (41%)
Similarity:159/277 (57%) Gaps:12/277 (4%)


  Fly    91 LTSPKTHHTRAIHIKRTWGRRCNKLIFMSTKADKELGSVALNVREGYSNLWPKTRAALQYVYKHH 155
            :|.|....|:|||:|.||.|.||..:|||:..|||..::.|...||...|:.||..|..|.:|::
 Frog     1 MTGPSNLQTKAIHVKNTWTRHCNVALFMSSVTDKEFPTIGLGTGEGRDKLYWKTIRAFHYAHKYY 65

  Fly   156 FQKYDWFLKADDDTYFIMENLRAFLHAHNFREPVYFGNKFRQHVKEGYMSGGAGYVLSKMALHRL 220
            ..:.|||||||||||.|::|||..|..:...:|:|||.:|:...|:||||||||||||:.||.|.
 Frog    66 LNETDWFLKADDDTYAIVDNLRWMLSNYTPDQPIYFGKRFKPFFKQGYMSGGAGYVLSREALIRF 130

  Fly   221 IKLGFSNSSICTNRNYGYEDVELGRCLAGVGVVGGDSRDEQGLSRFIPFSP-----LHWYPQPPD 280
            :: || .:.||.:.. ..|||.:|.|:..:||:.|||||.:....|.||:|     :.:.....:
 Frog   131 VE-GF-RTGICRHIT-PTEDVAMGNCMQLMGVIAGDSRDTEKRETFNPFAPESQLTVKYSEHKEN 192

  Fly   281 WYQPLLYYTSPDNSSDCCSNTAISFHYNNAQEFYVLEYIIYKLRIFGIN-RELGPLPKKKASSRP 344
            ||....:|...: ...|||:.|||:||.:.:..|.|||..|..|.:|.. |...||| :.|.:.|
 Frog   193 WYWVYCFYPIVE-GPQCCSDLAISYHYISPELMYTLEYFTYHFRPYGYQYRYQPPLP-ENAHNLP 255

  Fly   345 MSINLQTTKEENGHIA 360
            :.:..:..| .||.||
 Frog   256 VHVQNEAIK-PNGTIA 270

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2975NP_608719.1 Galactosyl_T 90..>214 CDD:304462 61/123 (50%)
LOC100486030XP_002933747.2 Galactosyl_T 9..>159 CDD:304462 72/153 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D555141at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.