DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2975 and LOC100485879

Sequence 1:NP_608719.1 Gene:CG2975 FlyBaseID:FBgn0031468 Length:385 Species:Drosophila melanogaster
Sequence 2:XP_002933746.2 Gene:LOC100485879 ID: Length:350 Species:Xenopus tropicalis

Alignment Length:355 Identity:137/356 (38%)
Similarity:193/356 (54%) Gaps:22/356 (6%)


  Fly    14 LMLLIGLAWGILLSELMKRTRWQNHADRLKEESSPFPSSQR-SRNLRTPPTIAPSTTNPPPDILA 77
            |.|.:|.:.|..::..|..|.|:     ||..   .|.:.| |.|....|....|..:.|.|..|
 Frog     4 LPLTLGASIGFFIAYFMVHTFWE-----LKPH---LPLAIRSSHNSEHMPADGISHFHLPEDTSA 60

  Fly    78 A-RLFNETRVLCMVLTSPKTHHTRAIHIKRTWGRRCNKLIFMSTKADKELGSVALNVREGYSNLW 141
            : .|:::.||||.::|.|....|:|||:|.||.|.||..:|||:..|||..::.|...||...|:
 Frog    61 SEELYSKVRVLCWIMTGPSNLQTKAIHVKNTWTRHCNVALFMSSVTDKEFPTIGLGTGEGRDKLY 125

  Fly   142 PKTRAALQYVYKHHFQKYDWFLKADDDTYFIMENLRAFLHAHNFREPVYFGNKFRQHVKEGYMSG 206
            .||..|..|.:|::..:.|||||||||:|.|::|||..|..:...:|:|||.:|:...|:|||||
 Frog   126 WKTIRAFHYAHKYYLNETDWFLKADDDSYAIVDNLRWMLSNYTPDQPIYFGKRFKPFFKQGYMSG 190

  Fly   207 GAGYVLSKMALHRLIKLGFSNSSICTNRNYGYEDVELGRCLAGVGVVGGDSRDEQGLSRFIPFSP 271
            |||||||:.||.|.:: || .:.|||:.. ..|||.:|.|:..:||..|||||.:....|.||||
 Frog   191 GAGYVLSREALIRFVE-GF-RTGICTHTT-PKEDVAMGNCMQLMGVTAGDSRDTEKRETFNPFSP 252

  Fly   272 -----LHWYPQPPDWYQPLLYYTSPDNSSDCCSNTAISFHYNNAQEFYVLEYIIYKLRIFGIN-R 330
                 :.:.....:||....:|...: ...|||:.|||:||...:..|.|||..|..|.:|.. |
 Frog   253 ESHLTVKYSEHKENWYWSYSFYPIVE-GPQCCSDLAISYHYIYPELMYTLEYFTYHFRPYGYQYR 316

  Fly   331 ELGPLPKKKASSRPMSINLQTTKEENGHIA 360
            ...||| :.|.:.|:.:..:..| .||.||
 Frog   317 YQPPLP-ENAHNLPVHVQNEAIK-PNGTIA 344

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2975NP_608719.1 Galactosyl_T 90..>214 CDD:304462 60/124 (48%)
LOC100485879XP_002933746.2 Galactosyl_T 83..>233 CDD:304462 72/153 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.