DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3119 and C1galt1

Sequence 1:NP_608717.2 Gene:CG3119 FlyBaseID:FBgn0031466 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_443719.3 Gene:C1galt1 MGIID:2151071 Length:363 Species:Mus musculus

Alignment Length:301 Identity:107/302 (35%)
Similarity:166/302 (55%) Gaps:42/302 (14%)


  Fly    62 RILCMVLTCPENVQSLARSVYETWGQRCSRLIFASSEDYEPLGVVGVVEPTGGGYEDLWNKTREG 126
            :|||.|:|.|:|::..|:.|..||.|||::::|.|||:.:....||:  .|..|.|.|:.||.:.
Mouse    88 KILCWVMTSPQNLEKKAKHVKATWAQRCNKVLFMSSEENQDFPTVGL--KTKEGREQLYWKTIKA 150

  Fly   127 FRHVWEHYAGDYDWFLKADDDTYVVMENLQHLLRGFDPNTPVFFGYKMSRY-NVSYMSGGASYIL 190
            |::|.:||..|.|||:||||||||:::||:.||..::|..|::||.:...| ...||||||.|:|
Mouse   151 FQYVHDHYLEDADWFMKADDDTYVIVDNLRWLLSKYNPEQPIYFGRRFKPYVKQGYMSGGAGYVL 215

  Fly   191 SREALHRFATQAYESEVICPQPKKMGIEDFYMGICMQNVGVHFVDSTHALDGDTKPKFMPLD--L 253
            |:|||.|| ..|:::|. |..  ...|||..:|.||:.:.|...||...:..:|...|:|..  :
Mouse   216 SKEALRRF-VNAFKTEK-CTH--SSSIEDLALGRCMEIINVEAGDSRDTIGKETFHPFVPEHHLI 276

  Fly   254 ENYMS------DANYTIPEWLRLMSLSRVETGLACCSNYSVAFHYASRERMFLYEFLIYHLKVFD 312
            :.|:.      :.||..|          :| |..|||:.:|:|||.....|:..|:|:|||:.: 
Mouse   277 KGYLPKTFWYWNYNYYPP----------IE-GPGCCSDIAVSFHYVDGTTMYELEYLVYHLRPY- 329

  Fly   313 PNQISERGHRSRLTLSDLTRRFPLEDNSNIKDLLQMSEKPD 353
                   |:        |.|..|....:.:|::.|::.|.|
Mouse   330 -------GY--------LYRYQPALPENILKEINQVNRKED 355

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3119NP_608717.2 Galactosyl_T 86..235 CDD:304462 64/150 (43%)
C1galt1NP_443719.3 Galactosyl_T 107..>248 CDD:304462 66/147 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23033
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.960

Return to query results.
Submit another query.