DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3119 and AT1G33250

DIOPT Version :9

Sequence 1:NP_608717.2 Gene:CG3119 / 33479 FlyBaseID:FBgn0031466 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_174595.1 Gene:AT1G33250 / 840219 AraportID:AT1G33250 Length:548 Species:Arabidopsis thaliana


Alignment Length:467 Identity:87/467 - (18%)
Similarity:139/467 - (29%) Gaps:200/467 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LHLLTGFMAGFVLAFVLLLYVYDVSRVTPCWSSTSTMTTATTARIEDGPPPRI---------LCM 66
            :.|:...|..|:      .|:|..|...||.|..|.            |||||         ..:
plant     1 MRLILTVMCSFI------PYLYSSSPHRPCSSPISR------------PPPRIRPCRLSRFATAL 47

  Fly    67 VLTCPENVQSLA--RSVYETWGQRCSRLIFASSEDYE-----------PLGVVGVVEPTG----- 113
            |.|....:.|:|  ..|:.....||..|:    :|:|           |:.......|:.     
plant    48 VATSALLLASVAWLSLVFSPTTSRCWHLL----KDWEDNHLWNKRYHHPIVTPPPPPPSPPSLPA 108

  Fly   114 ------------------------------GGYEDLWNKTREGFR----------HVW------- 131
                                          .|...||.:.:|..|          |||       
plant   109 LPLFDHEFRNRSLSEIDKLDLSMNHLMFGIAGSSQLWERRKELVRLWWKPSQMRGHVWLEEQVSP 173

  Fly   132 -------------------------EHYAG----------------DYDWFLKADDDTYVVMENL 155
                                     .|.:|                :..||:..||||...:.||
plant   174 EEGDDSLPPIIVSEDSSRFRYTNPTGHPSGLRISRIAMESFRLSLPNVRWFVLGDDDTIFNVHNL 238

  Fly   156 QHLLRGFDPNTPVFFG-----YKMSRY---NVSYMSGG--ASYILSREALHRFATQAYESEVICP 210
            ..:|..:||:..|:.|     :..:.|   |:::..||  .||.|: |||.|.     ..:.:..
plant   239 LAVLSKYDPSEMVYIGNPSESHSANSYFSHNMAFGGGGIAISYPLA-EALSRI-----HDDCLDR 297

  Fly   211 QPKKMGIEDFYMGICMQNVGVHFVDSTHALDGDTKPKFMPLDLE---NYMSDANYTIPEWLRLMS 272
            .||..|.:| .:..|:..:||..         ..:|.|...|::   :.:..::...|    .:|
plant   298 YPKLYGSDD-RLHACITELGVPL---------SREPGFHQWDIKGNAHGLLSSHPIAP----FVS 348

  Fly   273 LSRVET------GLACCSNYSVAFHYASRERMFLYEFLIYHLKVFDPNQISERG----HRSRLT- 326
            :..||.      ||:...:..                |:......||..:.:|.    |..:|| 
plant   349 IHHVEAVNPLYPGLSTLDSLK----------------LLTRAMSLDPRSVLQRSICYDHTHKLTF 397

  Fly   327 ---LSDLTRRFP 335
               |..:.:.||
plant   398 AISLGYVVQVFP 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3119NP_608717.2 Galactosyl_T 86..235 CDD:304462 48/262 (18%)
AT1G33250NP_174595.1 Galactosyl_T 17..548 CDD:304462 82/445 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.