DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3119 and AT5G12460

Sequence 1:NP_608717.2 Gene:CG3119 FlyBaseID:FBgn0031466 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_568279.2 Gene:AT5G12460 AraportID:AT5G12460 Length:441 Species:Arabidopsis thaliana

Alignment Length:369 Identity:74/370 (20%)
Similarity:119/370 (32%) Gaps:117/370 (32%)


  Fly    42 SSTSTMTTATTARIEDGPPPRI--LCMVLTCPENVQSLARSVYETWGQRCSRLIFASSEDYEP-- 102
            ||:|:.:.:.:.:|...||..|  |..|:..........|...|.|              :.|  
plant    17 SSSSSSSVSLSLQITREPPTNISHLFFVIVGSTKTWRYRRGYIEPW--------------WRPNI 67

  Fly   103 -LGVVGVVEPTGGGYEDL--W-------NKTREGF---------------RHVWEHYAGDYDWFL 142
             .|.|.:..|.|   .||  |       :..:|.|               :..::..:.:..||:
plant    68 TKGYVFLERPPG---PDLLPWPQQSPPFSVNKESFITNKFKTQIRLFYSLQESFKKASKETRWFV 129

  Fly   143 KADDDTYVVMENLQHLLRGFDPNTPVFFGYKMSR--------YNVSYMSGGASYILSREALHRFA 199
            ..||||...::||...|..::.....:.|.....        :::.|  ||..|.||...:....
plant   130 IGDDDTLFFLDNLVKALDRYNHKKHYYVGMNSENVWSNAIFAFDMGY--GGGGYALSYPTVVTLL 192

  Fly   200 TQAYESEVICPQPKKMGI-EDFYMGICMQNVGVHFVDST-------HALDGD------TKPKFMP 250
            :...|    |.: :.:|: .|.....|:.::|   :|.|       :.|.||      ..|: .|
plant   193 SNMEE----CIK-RYLGVYSDLLSFRCLADLG---IDLTLEKGMHQNDLHGDISGLLSAHPQ-SP 248

  Fly   251 LDLENYMSDANYTIPEWLRLMSL-----------SRVETGLACCS---NYSVAFHYASRERMFLY 301
            |...::....:...|...|..|:           |||.....|..   |:||:..:.       |
plant   249 LISLHHFDVIDPIFPGMNRQQSVNHLMETAKTDQSRVLQQTICYQRGYNWSVSVSWG-------Y 306

  Fly   302 EFLIYHLKVFDPNQISERGHRSRLTLSDLTRRFPLEDNSNIKDL 345
            ...||       ..|..|.|..|          |||.....||:
plant   307 SVHIY-------QSIYPRSHLKR----------PLETFRPWKDV 333

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3119NP_608717.2 Galactosyl_T 86..235 CDD:304462 32/185 (17%)
AT5G12460NP_568279.2 Galactosyl_T <126..>184 CDD:304462 15/60 (25%)
Galactosyl_T 167..416 CDD:304462 42/203 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
10.910

Return to query results.
Submit another query.