DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3119 and C1galt1

Sequence 1:NP_608717.2 Gene:CG3119 FlyBaseID:FBgn0031466 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_006236153.1 Gene:C1galt1 RGDID:621105 Length:390 Species:Rattus norvegicus

Alignment Length:301 Identity:107/302 (35%)
Similarity:166/302 (55%) Gaps:42/302 (14%)


  Fly    62 RILCMVLTCPENVQSLARSVYETWGQRCSRLIFASSEDYEPLGVVGVVEPTGGGYEDLWNKTREG 126
            ::||.|:|.|:|::..|:.|..||.|||::::|.|||:.:....||:  .|..|.|.|:.||.:.
  Rat   115 KVLCWVMTSPQNLEKKAKHVKATWAQRCNKVLFMSSEENKDFPTVGL--ETKEGREQLYWKTIKA 177

  Fly   127 FRHVWEHYAGDYDWFLKADDDTYVVMENLQHLLRGFDPNTPVFFGYKMSRY-NVSYMSGGASYIL 190
            |::|.:||..|.|||:||||||||:::||:.||..::|..|::||.:...| ...||||||.|:|
  Rat   178 FQYVHDHYLEDADWFMKADDDTYVILDNLRWLLSKYNPEQPIYFGRRFKPYVKQGYMSGGAGYVL 242

  Fly   191 SREALHRFATQAYESEVICPQPKKMGIEDFYMGICMQNVGVHFVDSTHALDGDTKPKFMPLD--L 253
            |:|||.|| ..|:::|. |..  ...|||..:|.||:.:.|...||......:|...|:|..  :
  Rat   243 SKEALRRF-VDAFKTEK-CTH--SSSIEDLALGRCMEIIKVEAGDSRDPTGKETFHPFVPEHHLI 303

  Fly   254 ENYMS------DANYTIPEWLRLMSLSRVETGLACCSNYSVAFHYASRERMFLYEFLIYHLKVFD 312
            :.|:.      :.||..|          || |..|||:.:|:|||.....|:..|:|:|||:.: 
  Rat   304 KGYLPKTFWYWNYNYYPP----------VE-GPGCCSDIAVSFHYVDSTTMYELEYLVYHLRPY- 356

  Fly   313 PNQISERGHRSRLTLSDLTRRFPLEDNSNIKDLLQMSEKPD 353
                   |:        |.|..|....:.:|::.|:::|.|
  Rat   357 -------GY--------LYRYQPALPENILKEINQVNKKED 382

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3119NP_608717.2 Galactosyl_T 86..235 CDD:304462 64/150 (43%)
C1galt1XP_006236153.1 Galactosyl_T 134..>275 CDD:304462 66/147 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23033
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
43.970

Return to query results.
Submit another query.