DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3119 and CG34452

Sequence 1:NP_608717.2 Gene:CG3119 FlyBaseID:FBgn0031466 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001097611.2 Gene:CG34452 FlyBaseID:FBgn0085481 Length:318 Species:Drosophila melanogaster

Alignment Length:276 Identity:74/277 (27%)
Similarity:124/277 (45%) Gaps:47/277 (17%)


  Fly    58 GPPP-RILCMVLTCPENVQSLARSVYETWGQRCSRLIFASSE---DYEPLGVVGVVEPTGGGYED 118
            |||| ||.|::.|........|..::.||.:.|...:|.|.:   ..||...:.:        .|
  Fly    48 GPPPARIFCIISTYAYRHGHAAIHIHRTWVRHCDHYLFVSDDIDNHLEPAVFMNM--------PD 104

  Fly   119 LWNKTREGFRHVWEHYAGDYDWFLKADDDTYVVMENLQHLLRGFDPNTPVFFGYKMSRYN-VSYM 182
            .|::.|....:|::::....||||..:||.:||::||:|:|:.:.|...::||.|:...| :.:|
  Fly   105 KWHRMRAYLEYVYKYHFHQGDWFLYCNDDNFVVVDNLRHMLKTYSPKELIYFGCKLRTTNGLVFM 169

  Fly   183 SGGASYILSREALHRFATQAYESEVICPQPKKMGIEDF--YMGICMQNVGVHFVDSTHALDGDTK 245
            ..|:..:.|..||.|||..|..:|.||....|.  .||  .:|.|:.||.|...||.   |...:
  Fly   170 LEGSGIVFSAAALKRFALTALTNESICSSETKG--NDFTKELGRCLTNVNVIAGDSR---DEFQR 229

  Fly   246 PKFMPLD------------LEN---YMSDANYTIPEWLRLMSLSRVETGLACCSNYSVAFHYASR 295
            .:|:|.|            |||   ::..:.|.:.:....:||            :|:.||....
  Fly   230 HRFLPFDADLHLGSSMNESLENHKYFLDHSYYPVNDMNLPVSL------------HSICFHVPYT 282

  Fly   296 ERMFLYEFLIYHLKVF 311
            ..::...:..|..::|
  Fly   283 LNIYDLYYFAYKTRIF 298

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3119NP_608717.2 Galactosyl_T 86..235 CDD:304462 46/155 (30%)
CG34452NP_001097611.2 Galactosyl_T 72..>183 CDD:304462 33/119 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C88690475
eggNOG 1 0.900 E1_KOG2246
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23033
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.