DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3119 and C1GALT1

Sequence 1:NP_608717.2 Gene:CG3119 FlyBaseID:FBgn0031466 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_005249869.1 Gene:C1GALT1 HGNCID:24337 Length:371 Species:Homo sapiens

Alignment Length:390 Identity:121/391 (31%)
Similarity:188/391 (48%) Gaps:74/391 (19%)


  Fly     4 KMKLRSQLHLLTGFMAGFVLAFVLLLYVYDVSRVTPCWSSTSTMTTATTARIEDG---------- 58
            :|..:|.|:.|| |:.|..:.|:|...::.:.......:..:.:.....||..|.          
Human     8 EMASKSWLNFLT-FLCGSAIGFLLCSQLFSILLGEKVDTQPNVLHNDPHARHSDDNGQNHLEGQM 71

  Fly    59 ---------------------PPPRILCMVLTCPENVQSLARSVYETWGQRCSRLIFASSEDYEP 102
                                 ...||||.|:|.|:|::..|:.|..||.|||::::|.|||:.:.
Human    72 NFNADSSQHKDENTDIAENLYQKVRILCWVMTGPQNLEKKAKHVKATWAQRCNKVLFMSSEENKD 136

  Fly   103 LGVVGVVEPTGGGYEDLWNKTREGFRHVWEHYAGDYDWFLKADDDTYVVMENLQHLLRGFDPNTP 167
            ...||:  .|..|.:.|:.||.:.|::|.|||..|.||||||||||||:::||:.||..:||..|
Human   137 FPAVGL--KTKEGRDQLYWKTIKAFQYVHEHYLEDADWFLKADDDTYVILDNLRWLLSKYDPEEP 199

  Fly   168 VFFGYKMSRY-NVSYMSGGASYILSREALHRFATQAYESEVICPQPKKMGIEDFYMGICMQNVGV 231
            ::||.:...| ...||||||.|:||:|||.|| ..|::::. |..  ...|||..:|.||:.:.|
Human   200 IYFGRRFKPYVKQGYMSGGAGYVLSKEALKRF-VDAFKTDK-CTH--SSSIEDLALGRCMEIMNV 260

  Fly   232 HFVDSTHALDGDTKPKFMPLD--LENYMS------DANYTIPEWLRLMSLSRVETGLACCSNYSV 288
            ...||...:..:|...|:|..  ::.|:.      :.||..|          || |..|||:.:|
Human   261 EAGDSRDTIGKETFHPFVPEHHLIKGYLPRTFWYWNYNYYPP----------VE-GPGCCSDLAV 314

  Fly   289 AFHYASRERMFLYEFLIYHLKVFDPNQISERGHRSRLTLSDLTRRFPLEDNSNIKDLLQMSEKPD 353
            :|||.....|:..|:|:|||:.:        |:        |.|..|......:|::.|.::..|
Human   315 SFHYVDSTTMYELEYLVYHLRPY--------GY--------LYRYQPTLPERILKEISQANKNED 363

  Fly   354  353
            Human   364  363

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3119NP_608717.2 Galactosyl_T 86..235 CDD:304462 65/150 (43%)
C1GALT1XP_005249869.1 Galactosyl_T 115..>256 CDD:304462 67/147 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23033
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.