DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3119 and C1GALT1

DIOPT Version :9

Sequence 1:NP_608717.2 Gene:CG3119 / 33479 FlyBaseID:FBgn0031466 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_064541.1 Gene:C1GALT1 / 56913 HGNCID:24337 Length:363 Species:Homo sapiens


Alignment Length:389 Identity:121/389 - (31%)
Similarity:187/389 - (48%) Gaps:74/389 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 MKLRSQLHLLTGFMAGFVLAFVLLLYVYDVSRVTPCWSSTSTMTTATTARIEDG----------- 58
            |..:|.|:.|| |:.|..:.|:|...::.:.......:..:.:.....||..|.           
Human     1 MASKSWLNFLT-FLCGSAIGFLLCSQLFSILLGEKVDTQPNVLHNDPHARHSDDNGQNHLEGQMN 64

  Fly    59 --------------------PPPRILCMVLTCPENVQSLARSVYETWGQRCSRLIFASSEDYEPL 103
                                ...||||.|:|.|:|::..|:.|..||.|||::::|.|||:.:..
Human    65 FNADSSQHKDENTDIAENLYQKVRILCWVMTGPQNLEKKAKHVKATWAQRCNKVLFMSSEENKDF 129

  Fly   104 GVVGVVEPTGGGYEDLWNKTREGFRHVWEHYAGDYDWFLKADDDTYVVMENLQHLLRGFDPNTPV 168
            ..||:  .|..|.:.|:.||.:.|::|.|||..|.||||||||||||:::||:.||..:||..|:
Human   130 PAVGL--KTKEGRDQLYWKTIKAFQYVHEHYLEDADWFLKADDDTYVILDNLRWLLSKYDPEEPI 192

  Fly   169 FFGYKMSRY-NVSYMSGGASYILSREALHRFATQAYESEVICPQPKKMGIEDFYMGICMQNVGVH 232
            :||.:...| ...||||||.|:||:|||.|| ..|::::. |..  ...|||..:|.||:.:.|.
Human   193 YFGRRFKPYVKQGYMSGGAGYVLSKEALKRF-VDAFKTDK-CTH--SSSIEDLALGRCMEIMNVE 253

  Fly   233 FVDSTHALDGDTKPKFMPLD--LENYMS------DANYTIPEWLRLMSLSRVETGLACCSNYSVA 289
            ..||...:..:|...|:|..  ::.|:.      :.||..|          || |..|||:.:|:
Human   254 AGDSRDTIGKETFHPFVPEHHLIKGYLPRTFWYWNYNYYPP----------VE-GPGCCSDLAVS 307

  Fly   290 FHYASRERMFLYEFLIYHLKVFDPNQISERGHRSRLTLSDLTRRFPLEDNSNIKDLLQMSEKPD 353
            |||.....|:..|:|:|||:.:        |:        |.|..|......:|::.|.::..|
Human   308 FHYVDSTTMYELEYLVYHLRPY--------GY--------LYRYQPTLPERILKEISQANKNED 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3119NP_608717.2 Galactosyl_T 86..235 CDD:304462 65/149 (44%)
C1GALT1NP_064541.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 41..72 3/30 (10%)
Galactosyl_T 107..>221 CDD:328824 56/115 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.