DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3119 and LOC564281

Sequence 1:NP_608717.2 Gene:CG3119 FlyBaseID:FBgn0031466 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_692721.4 Gene:LOC564281 ID: Length:341 Species:Danio rerio

Alignment Length:320 Identity:103/321 (32%)
Similarity:164/321 (51%) Gaps:33/321 (10%)


  Fly     6 KLRSQLHLLTGFMAGFVLAFVLLLYVYDVSRVTP-----------CWSSTSTMTTATTARIEDGP 59
            ::...|.|..|.:.|||....|:....:...:||           .|:..:.:..:...|:    
Zfish    17 QISPHLLLFCGILLGFVFVQQLVYLRIEGRTLTPAHILSSHAKSHAWNKKADLVQSLYPRV---- 77

  Fly    60 PPRILCMVLTCPENVQSLARSVYETWGQRCSRLIFASSE--DYEPLGVVGVVEPTGGGYEDLWNK 122
              |:||.::|.|||:|...:.|..||.|.|:.:::.||:  |:..:| :.|.|    |...|:.|
Zfish    78 --RVLCWIMTRPENLQKRLQHVNATWAQHCNLVLYMSSQSSDFPTVG-LNVSE----GRSQLYWK 135

  Fly   123 TREGFRHVWEHYAGDYDWFLKADDDTYVVMENLQHLLRGFDPNTPVFFGYKMSRY-NVSYMSGGA 186
            |...|:|:.:|:....||||||||||:||:|||::||...|...|::||:|...: ...||||||
Zfish   136 TIRAFQHIQKHHLQHADWFLKADDDTFVVLENLRYLLSQHDTEKPLYFGHKFRPFVRQGYMSGGA 200

  Fly   187 SYILSREALHRFATQAYESEVICPQPKKMGIEDFYMGICMQNVGVHFVDSTHALDGDTKPKFMPL 251
            .|:||||||.||.    :..|.........:||..:|.||:.:||..||:.   |.:.:..|.|.
Zfish   201 GYVLSREALRRFV----QGFVTGRCTHFSSLEDMALGRCMEIMGVKAVDTR---DANLRETFNPF 258

  Fly   252 DLENYMSDANYTIPEWLRLMSLSRVETGLACCSNYSVAFHYASRERMFLYEFLIYHLKVF 311
            ..:.::...:.| .:...|.|..:.:.|..|||::.::|||.....|::.|:..|||:.|
Zfish   259 WPDKHLIHKDNT-KKQDSLYSYYKTKLGPECCSDFVISFHYLRAADMYMLEYYTYHLRPF 317

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3119NP_608717.2 Galactosyl_T 86..235 CDD:304462 61/152 (40%)
LOC564281XP_692721.4 Galactosyl_T <153..>244 CDD:304462 44/95 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C158953759
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23033
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.