DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3119 and b3glctb

Sequence 1:NP_608717.2 Gene:CG3119 FlyBaseID:FBgn0031466 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001289177.1 Gene:b3glctb ZFINID:ZDB-GENE-091204-128 Length:493 Species:Danio rerio

Alignment Length:228 Identity:54/229 (24%)
Similarity:89/229 (39%) Gaps:32/229 (14%)


  Fly    40 CWSSTSTMTTATTARI--EDGPPPRILCMVLTCPENVQSLARSVYETWGQRCSRLIFAS--SEDY 100
            |.::.:|..:|....:  ||     :...|.||....:.....|.:||.:..:.|.:.|  ::..
Zfish   247 CATAVNTYLSACGKPVLKED-----VFVAVKTCQRFHRDRVPIVKQTWEKDAASLEYYSDVTDSI 306

  Fly   101 EPLGVVGVVEPTGGGYEDLWNKTREGFRHVWEHYAGDYDWFLKADDDTYVVMENLQHLLRGFDPN 165
            .|...:||.....|..|    ||....|...........|.|..||||.:.:..|:.||..:||.
Zfish   307 IPTVHLGVPNTERGHCE----KTFAILRRFASGAVTQAPWLLIVDDDTLISLPRLRRLLSCYDPT 367

  Fly   166 TPVF----FGYKMSRYNVSYMSGGASYILSREALHRFATQAYESEVICPQPKKMGIEDFYMGICM 226
            ..|.    :||.:||...||::||...:.||.|:.......      |........:|..:|:|:
Zfish   368 EAVSVGERYGYGLSRDGYSYITGGGGMVFSRVAVQNILAGG------CSCRSSDAPDDMVLGMCL 426

  Fly   227 QNVGVHFVDSTHALDGDTKPKFMPLDLENYMSD 259
            ..:|   :..||:      |.|.....::|:.:
Zfish   427 TTLG---LPVTHS------PLFHQARPDDYVKE 450

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3119NP_608717.2 Galactosyl_T 86..235 CDD:304462 38/155 (25%)
b3glctbNP_001289177.1 Galactosyl_T <121..>193 CDD:304462
Galactosyl_T 264..465 CDD:304462 51/212 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.