DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3119 and c1galt1a

Sequence 1:NP_608717.2 Gene:CG3119 FlyBaseID:FBgn0031466 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001070842.1 Gene:c1galt1a ZFINID:ZDB-GENE-061013-303 Length:408 Species:Danio rerio

Alignment Length:382 Identity:118/383 (31%)
Similarity:179/383 (47%) Gaps:63/383 (16%)


  Fly    16 GFMAGFVLAFVLLLYVY--------DVSRVTPC-------WSSTSTMTTATTARI---------E 56
            ||:.|....:|.|..|:        ...|.:|.       .||..|.....:|.|         |
Zfish    16 GFLVGSCSLYVFLRQVWFEESFSWQSNGRSSPSPPISHEQNSSNLTWRVEGSALINLKHPNQPGE 80

  Fly    57 DG-------PPPRILCMVLTCPENVQSLARSVYETWGQRCSRLIFASSEDYEPLGVVGVVEPTGG 114
            ||       ...||||.|:|.|.|:||.|:.|..||.:.|:.::|.|||:......||:  .||.
Zfish    81 DGHIADELFKKVRILCWVMTGPSNLQSKAQHVKNTWSRHCNVVLFMSSEEDRSFPTVGL--GTGE 143

  Fly   115 GYEDLWNKTREGFRHVWEHYAGDYDWFLKADDDTYVVMENLQHLLRGFDPNTPVFFGYKMSRY-N 178
            |.:.|:.||...|.:..:::..:.||||||||||:||::||:.:|..:.|..|::||.:...| .
Zfish   144 GRDQLYWKTIRAFHYALKNHGHEADWFLKADDDTFVVVDNLRWILSNYTPEQPIYFGKRFKPYTK 208

  Fly   179 VSYMSGGASYILSREALHRFATQAYESEVICPQPKKMGIEDFYMGICMQNVGVHFVDSTHALDGD 243
            ..||||||.|:||:|||.|| .:.:.::| |.....  :||..||.|::.:||...||..:|..:
Zfish   209 QGYMSGGAGYVLSKEALRRF-VEGFSTKV-CTHTTP--VEDLAMGQCLEKMGVLAGDSRDSLHRE 269

  Fly   244 TKPKFMPLDLENYMSDANYTIPEWLRLMSLSRVETGLACCSNYSVAFHYASRERMFLYEFLIYHL 308
            |...|:|   |:::: ..::...|........:..|..|||:.:|:|||.....|:..|:..|||
Zfish   270 TFHPFIP---EHHLT-GKFSKTFWYWNYCYYPIVEGPQCCSDLAVSFHYVDPVLMYTLEYYTYHL 330

  Fly   309 KVFDPNQISERGHRSRL-------------TLSDLTRRFPLEDNSNIKDLLQMSEKP 352
            :.|        |::.|.             |:...|.....|:.:..|..|..|..|
Zfish   331 RPF--------GYQHRYQPPVPAVLSLLSQTVKTTTETQRSEEGAKEKPALTNSVNP 379

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3119NP_608717.2 Galactosyl_T 86..235 CDD:304462 57/150 (38%)
c1galt1aNP_001070842.1 Galactosyl_T <169..292 CDD:304462 50/131 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23033
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.